SecReT6
Protein ID: 170731803
SecReT6 ID264
T6SS typei4b
Gene symbol-
Locus tagBcenmc03_0450
StrainBurkholderia cenocepacia MC0-3
Repliconchromosome I [GenBank: NC_010508] [Browse all T6SS(s) in this replicon]
Location [Strand]487981..489081 [+]
Producttype VI secretion protein
NoteTssG
UniProt IDB1JUP2
KEGG IDbcm:Bcenmc03_0450
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.90E-94, Aligned region: 18..347
Protein Sequence: 366 a.a.     [Download]
>gi|170731803|ref|YP_001763750.1| type VI secretion protein [Burkholderia cenocepacia MC0-3]
MQAPNRRIDPGVVDALLDEPHRFEFFQAVRVLEGLFARQASDAPGAWRQGDVVAQHIAFRNTLSLGFPPS
EIEGARSFDDDGAPLNSDDERDAALAAGELGRVELTPAFFGLLGGQGALPLHYTEQIVAREHLRRDHAAR
AFFDVFSNRATALFYAAWKKYRLPFHYELDRDERYLPLLLAIAGVPSDEVRDSLAAGPGGVLDEAVAGYA
LAARHRPMSAAYLQRTLSDYFRVPVKIDQFVGKWYDVPSDQLSVLGEVNAVLGATALVGERVWQRDMRAR
IVVGPLSKRDYEAFLPGGAHAVALERMLTLLAGVTLEYEVKLVLKRTEVGASVLGAGSRLGWDAFLCTRD
ALEDRSDARYELHVIH
 
Nucleotide Sequence: 1101 bp     [Download]
>gi|170731356|ref|NC_010508.1|:487981-489081 Burkholderia cenocepacia MC0-3 chromosome 1, complete sequence
ATGCAAGCCCCGAACCGGCGAATCGATCCTGGCGTAGTCGACGCGCTGCTCGACGAGCCGCACCGCTTCG
AGTTCTTCCAGGCGGTGCGGGTGCTCGAAGGGCTGTTCGCGCGGCAGGCGTCGGATGCGCCCGGCGCGTG
GCGGCAGGGCGACGTGGTCGCGCAGCACATCGCATTCCGCAACACGCTGTCGCTCGGCTTCCCGCCGAGC
GAGATCGAAGGCGCGCGTTCGTTCGACGACGACGGCGCGCCACTGAACTCGGACGACGAGCGCGACGCCG
CGCTGGCCGCCGGCGAGCTCGGCCGCGTCGAGCTGACGCCCGCGTTCTTCGGGCTGCTCGGCGGGCAGGG
CGCGCTGCCGCTGCACTACACCGAGCAGATCGTCGCGCGCGAGCACTTGCGGCGCGATCACGCGGCGCGC
GCGTTCTTCGACGTGTTCTCGAACCGCGCGACCGCGCTGTTCTATGCGGCGTGGAAGAAATACCGGCTGC
CGTTCCATTACGAGCTCGACCGCGACGAGCGCTACCTGCCGCTGTTGCTCGCGATCGCGGGCGTGCCGAG
CGACGAGGTGCGCGACAGCCTCGCGGCCGGCCCGGGCGGCGTGCTCGACGAAGCCGTGGCCGGCTATGCG
CTCGCGGCGCGGCACCGGCCGATGTCGGCCGCGTACCTGCAGCGCACGCTGTCCGATTACTTCCGCGTGC
CGGTGAAGATCGACCAGTTCGTCGGCAAGTGGTACGACGTGCCGTCCGATCAGCTGAGCGTGCTCGGCGA
AGTCAACGCGGTGCTCGGCGCGACGGCGCTCGTCGGCGAGCGCGTGTGGCAGCGCGACATGCGCGCGCGG
ATCGTCGTCGGCCCGCTGTCCAAGCGCGACTACGAAGCGTTCCTGCCCGGCGGCGCGCACGCCGTCGCGC
TCGAGCGGATGCTGACGCTGCTCGCCGGCGTCACGCTCGAGTACGAGGTGAAGCTCGTGCTCAAGCGCAC
CGAGGTCGGCGCGAGCGTGCTCGGCGCGGGCTCGCGGCTCGGCTGGGATGCGTTCCTGTGCACGCGCGAT
GCACTGGAGGACCGCTCAGACGCCCGCTACGAACTGCACGTGATTCACTGA