SecReT6
Protein ID: 170731805
SecReT6 ID264
T6SS typei4b
Gene symbol-
Locus tagBcenmc03_0452
StrainBurkholderia cenocepacia MC0-3
Repliconchromosome I [GenBank: NC_010508] [Browse all T6SS(s) in this replicon]
Location [Strand]491837..492958 [+]
ProductImpA family type VI secretion-associated protein
NoteTssA
UniProt IDB1JUP4
KEGG IDbcm:Bcenmc03_0452
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 6.40E-24, Aligned region: 55..116
Protein Sequence: 373 a.a.     [Download]
>gi|170731805|ref|YP_001763752.1| ImpA family type VI secretion-associated protein [Burkholderia cenocepacia MC0-3]
MPINLPELLTPISDASPSGDDLLFSNEFDAIQDARRYDDPTLDQGEWVTEIKEADWGFVVDHAGELLRTR
TKDLRLAVWLTEALALEDGITGLTEGYALLEGLCRDFWDTFHPLPEDDDIEHRLGNVAWLSGRTAELLRA
VPLTDGASNAFSTLDWEVAQHVAQSIKRDPEHADDIARGKPSIDQIDASRRVTSIAFYTALLANLKAFEF
ALDAFEERLVERAGDWAPSFRQARDAFETVYRLAERFAREQGYTGSAPHAQAAPQAQPERIEPVFGQPIQ
TEETHVQQQTASRPPVTQMIAGIQNRAQAVDQLRAVARYFRQTEPHSPVAYLADKAAEWADMPLHKWLES
VVKDDGSLSHIRELLGVRPDEQA
 
Nucleotide Sequence: 1122 bp     [Download]
>gi|170731356|ref|NC_010508.1|:491837-492958 Burkholderia cenocepacia MC0-3 chromosome 1, complete sequence
ATGCCGATCAATCTCCCCGAGCTGCTGACGCCGATCAGCGATGCGTCGCCCAGCGGCGACGACCTGCTGT
TTTCGAACGAATTCGACGCGATTCAGGACGCGCGGCGCTACGACGACCCGACGCTCGACCAGGGCGAATG
GGTCACCGAGATCAAGGAGGCCGACTGGGGCTTCGTCGTCGACCATGCGGGCGAGCTGCTGCGCACCCGC
ACCAAGGACCTGCGGCTTGCCGTGTGGCTGACCGAGGCGCTCGCGCTCGAGGACGGCATCACGGGCCTCA
CCGAAGGCTATGCGCTGCTCGAAGGCCTGTGCCGCGACTTCTGGGACACCTTCCACCCGCTGCCCGAGGA
CGACGACATCGAGCACCGGCTCGGCAACGTCGCGTGGCTGTCCGGCCGCACGGCCGAGCTGCTGCGCGCG
GTGCCGCTGACGGACGGCGCATCGAATGCGTTCAGCACGCTCGACTGGGAAGTCGCGCAGCACGTCGCGC
AGTCGATCAAGCGCGACCCCGAACACGCGGACGACATCGCGCGCGGCAAGCCGTCGATCGACCAGATCGA
CGCGTCGCGGCGCGTGACGTCGATCGCGTTCTACACGGCGCTGCTAGCGAACCTGAAGGCGTTCGAATTC
GCGCTCGATGCGTTCGAGGAGCGGCTCGTCGAGCGCGCGGGCGATTGGGCGCCGAGCTTCCGGCAGGCGC
GCGACGCGTTCGAGACCGTGTACCGGCTCGCCGAGCGCTTTGCGCGCGAACAGGGCTATACGGGCAGCGC
GCCGCACGCGCAGGCGGCGCCGCAGGCCCAGCCCGAACGCATCGAGCCGGTGTTCGGCCAGCCGATCCAG
ACCGAGGAGACTCACGTGCAGCAGCAGACCGCTTCGCGTCCGCCGGTGACGCAGATGATCGCCGGCATCC
AGAACCGTGCGCAGGCCGTCGACCAGTTGCGCGCGGTGGCGCGCTATTTCCGTCAGACCGAGCCGCACAG
CCCGGTCGCGTATCTCGCCGACAAGGCGGCCGAATGGGCAGACATGCCGCTGCACAAGTGGCTCGAGAGC
GTCGTGAAGGACGACGGCTCGCTGTCGCACATTCGCGAGCTGCTGGGGGTGAGGCCCGACGAGCAGGCGT
GA