SecReT6
Protein ID: 171060722
SecReT6 ID265
T6SS typei3
Gene symbol-
Locus tagLcho_4054
StrainLeptothrix cholodnii SP-6
Repliconchromosome [GenBank: NC_010524] [Browse all T6SS(s) in this replicon]
Location [Strand]4540240..4540833 [+]
Producthypothetical protein
NoteTssJ
UniProt IDB1XWV7
KEGG IDlch:Lcho_4054
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.30E-40, Aligned region: 41..191
Protein Sequence: 197 a.a.     [Download]
>gi|171060722|ref|YP_001793071.1| hypothetical protein Lcho_4054 [Leptothrix cholodnii SP-6]
MTEARVKSALKSSPSSIPAAADSARDAASRARRSVLAGAGALLLAGCSTSAKVIKALTAPEPEAKPEPEP
TRIVGALVASADINPDLRKRASPLLVRVYELKSDAAFNNADFMALFQRDQAELAADIVLREEFIVQPGER
RVLDRVAGEQTRFLAVFAAYRDIERARWRALAPVRSAATQTLQVQVDASAVSITPAR
 
Nucleotide Sequence: 594 bp     [Download]
>gi|171056692|ref|NC_010524.1|:4540240-4540833 Leptothrix cholodnii SP-6 chromosome, complete genome
ATGACGGAGGCCCGCGTGAAGTCCGCACTGAAGTCGTCCCCGAGCTCGATTCCTGCCGCTGCAGACAGCG
CCCGAGACGCGGCCAGTCGTGCGCGCCGCAGCGTGCTGGCCGGCGCGGGCGCGCTGCTGCTGGCCGGCTG
CTCGACCTCGGCCAAGGTGATCAAGGCGCTGACCGCGCCCGAGCCCGAAGCCAAGCCGGAGCCCGAACCG
ACCCGCATCGTCGGCGCGCTGGTCGCCAGCGCCGACATCAACCCGGACCTGCGCAAGCGCGCCTCGCCGC
TGCTGGTGCGGGTCTACGAGCTGAAGTCGGACGCGGCCTTCAACAACGCCGACTTCATGGCGCTGTTCCA
GCGCGACCAGGCCGAGCTGGCGGCCGACATCGTGCTGCGCGAGGAGTTCATCGTCCAGCCCGGCGAGCGC
CGCGTGCTCGACCGCGTGGCCGGCGAGCAGACCCGCTTCCTGGCGGTCTTCGCGGCCTATCGCGACATCG
AGCGGGCCCGCTGGCGCGCCCTGGCGCCGGTGCGCAGCGCCGCCACCCAGACGCTGCAGGTGCAGGTCGA
CGCGTCCGCGGTCTCGATCACCCCCGCCCGCTGA