SecReT6
Protein ID: 171060723
SecReT6 ID265
T6SS typei3
Gene symbol-
Locus tagLcho_4055
StrainLeptothrix cholodnii SP-6
Repliconchromosome [GenBank: NC_010524] [Browse all T6SS(s) in this replicon]
Location [Strand]4540844..4542181 [+]
Producttype VI secretion protein
NoteTssK
UniProt IDB1XWV8
KEGG IDlch:Lcho_4055
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 7.10E-139, Aligned region: 19..444
Protein Sequence: 445 a.a.     [Download]
>gi|171060723|ref|YP_001793072.1| type VI secretion protein [Leptothrix cholodnii SP-6]
MTLHDKVAWSQGMFLQPHHFQQETRALEHLIDTRLRAADAHAWGHAELVLDESLLALGRVGLVRARGVLP
DGTPYALPDHDPLPAPLEVPADLKGERVCLAAPLARAGATDFDLGLDGSAADAARYGVTELQLRDQTNAT
DEPQTIQVGRLRLRLLRERELGNGWTALGVARVIERRADAQVVLDRAYIPPQTRLDATEHLHASAALLHG
RLQQFARLLAERMGSAAHGVSEIADFLLLMTLNRNEPLFRQFAGGPQVHPALFHRACLQLAGELSSFGTD
SRTPREFALYRHDDLQATFATLIEQLRVQLSGVPVPRATPIELTDRQHGFRTAVIRDTELLRGAAFVLAV
HAQLPAEQLSQRFLAHAKVGPVERIKELVSLALPGIALRSLPVAPRQLPFHAGHHYFEVQRDGELWKQLE
HSGNLALHVAGDFPGLELQLWAIRP
 
Nucleotide Sequence: 1338 bp     [Download]
>gi|171056692|ref|NC_010524.1|:4540844-4542181 Leptothrix cholodnii SP-6 chromosome, complete genome
ATGACCCTGCATGACAAGGTCGCGTGGTCGCAGGGCATGTTCCTGCAGCCGCACCATTTCCAGCAGGAAA
CGCGTGCGCTCGAACACCTGATCGACACCCGCCTGCGTGCCGCCGACGCGCACGCCTGGGGCCACGCCGA
GCTGGTGCTCGACGAATCGCTGCTCGCACTCGGCCGCGTCGGCCTGGTGCGCGCGCGTGGCGTGCTGCCC
GACGGCACGCCCTACGCGCTGCCCGATCACGACCCGCTGCCCGCCCCGCTCGAGGTGCCGGCCGACCTCA
AGGGCGAGCGGGTCTGCCTGGCCGCGCCCCTGGCGCGTGCGGGCGCCACCGATTTCGACCTCGGCCTCGA
CGGCAGCGCCGCCGACGCCGCGCGCTACGGCGTCACCGAGCTGCAGCTGCGCGACCAGACCAACGCCACC
GACGAGCCGCAGACGATCCAGGTCGGCCGCCTGCGGCTGCGGCTGCTGCGCGAGCGCGAACTCGGCAACG
GCTGGACGGCGCTGGGCGTGGCGCGCGTGATCGAGCGCCGCGCCGACGCCCAGGTGGTGCTCGACCGCGC
CTACATCCCGCCGCAGACCCGGCTCGACGCCACCGAGCACCTGCACGCCTCGGCCGCGCTGCTGCACGGG
CGGCTGCAGCAGTTCGCCCGCCTGCTGGCCGAGCGCATGGGCAGCGCGGCGCACGGCGTCTCCGAGATCG
CCGACTTCCTGCTGCTGATGACGCTCAACCGCAACGAGCCGCTGTTCCGCCAGTTCGCCGGCGGCCCGCA
GGTGCACCCGGCGCTGTTCCACCGCGCCTGCCTGCAGCTGGCCGGCGAGCTCAGCAGCTTCGGCACCGAC
AGCCGCACGCCGCGCGAGTTCGCGCTCTATCGGCACGACGACCTGCAGGCCACCTTCGCGACGCTGATCG
AGCAGCTGCGCGTGCAGCTGTCGGGCGTGCCGGTGCCACGCGCCACGCCGATCGAGCTGACCGACCGCCA
GCACGGCTTCCGCACCGCCGTGATCCGCGACACCGAGCTGCTGCGCGGCGCCGCCTTCGTGCTGGCGGTG
CACGCGCAGCTGCCGGCCGAGCAGCTCAGCCAGCGCTTCCTGGCGCACGCCAAGGTCGGCCCGGTCGAGC
GCATCAAGGAGCTGGTCAGCCTGGCGCTGCCCGGCATCGCGCTGCGCAGCCTGCCGGTGGCGCCGCGCCA
GCTGCCGTTCCACGCCGGCCATCACTACTTCGAGGTGCAGCGCGACGGCGAGCTGTGGAAGCAGCTCGAA
CACAGCGGCAACCTGGCGCTGCACGTGGCCGGCGACTTCCCCGGGCTCGAGCTGCAGCTGTGGGCGATCC
GGCCCTGA