SecReT6
Protein ID: 171060724
SecReT6 ID265
T6SS typei3
Gene symbol-
Locus tagLcho_4056
StrainLeptothrix cholodnii SP-6
Repliconchromosome [GenBank: NC_010524] [Browse all T6SS(s) in this replicon]
Location [Strand]4542212..4543594 [+]
Producthypothetical protein
NoteTssL
UniProt IDB1XWV9
KEGG IDlch:Lcho_4056
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 3.60E-65, Aligned region: 61..266
OmpA [PF00691], Evalue: 8.20E-18, Aligned region: 210..222
OmpA [PF00691], Evalue: 8.20E-18, Aligned region: 329..427
Protein Sequence: 460 a.a.     [Download]
>gi|171060724|ref|YP_001793073.1| hypothetical protein Lcho_4056 [Leptothrix cholodnii SP-6]
MSAQPPRPGAGPNDPHDPFAALDSGATVIRPNPGARAAPARMPAAQEPPAADTPLPAQGLNPLVSLANRL
LLAVPQLRATRHVADPAALKHSLAQAVRDFSTAAAAAGITPQQVMAARYVLCTVLDEAASDTPWGGAGVW
AQHSLLVTFHNEAWGGEKVFQLMARLAGQPAEHRDLLELIYAALALGFEGRFRAIENGRAQLDAVRDKLA
RIVLQARGDHAPALAQHWQVEAVAQRALPGWLPLLVTALVLGLLLVAAYIGLSFWLGARSDPVFGQIQGL
RLNPPVAAVAQPAPQPRLATFLRPEIAEGAVVVRDEVDRSVVTLRGDGLFEPGSATLAAPKEALLRRVAD
ALAQFGGAVLVTGHTDSQPIRSARFPSNWHLSQERAGAVRELLVSQQVATERVRAEGRADGEPVVANDSA
GNRALNRRVEITLFVAAPPGVATAARPATPTATPASGARP
 
Nucleotide Sequence: 1383 bp     [Download]
>gi|171056692|ref|NC_010524.1|:4542212-4543594 Leptothrix cholodnii SP-6 chromosome, complete genome
ATGTCCGCCCAGCCCCCCCGCCCCGGTGCCGGTCCGAACGATCCGCACGATCCGTTCGCGGCGCTCGACA
GCGGCGCCACCGTCATCCGCCCCAACCCCGGCGCCCGCGCCGCGCCGGCGCGCATGCCGGCCGCCCAGGA
GCCGCCGGCCGCCGACACGCCGCTGCCGGCGCAGGGCCTGAATCCGCTGGTCAGCCTGGCCAACCGCCTG
CTGCTGGCGGTGCCGCAGCTGCGCGCGACCCGCCACGTCGCCGACCCCGCCGCGCTCAAGCACAGCCTGG
CGCAGGCGGTGCGCGACTTCAGCACCGCCGCCGCCGCCGCCGGCATCACGCCGCAGCAGGTGATGGCCGC
GCGCTACGTGCTGTGCACCGTGCTCGACGAGGCCGCCAGCGACACGCCCTGGGGCGGCGCCGGCGTGTGG
GCCCAGCACAGCCTGCTGGTGACCTTCCACAACGAGGCCTGGGGCGGCGAGAAGGTCTTCCAGCTGATGG
CCCGGCTGGCCGGCCAGCCGGCCGAACACCGCGACCTGCTGGAGCTGATCTACGCCGCGCTGGCGCTCGG
TTTCGAGGGGCGTTTCCGCGCCATCGAGAACGGCCGCGCCCAGCTCGACGCGGTGCGCGACAAGCTCGCG
CGCATCGTGCTGCAGGCGCGTGGCGACCACGCCCCGGCGCTGGCGCAGCACTGGCAGGTCGAGGCGGTGG
CGCAGCGCGCGCTGCCGGGCTGGCTGCCGCTGCTGGTGACGGCGCTGGTGCTGGGCCTGCTGCTGGTGGC
CGCCTACATCGGCCTGAGCTTCTGGCTCGGCGCGCGCTCCGACCCGGTGTTCGGCCAGATCCAGGGCCTG
CGCCTGAACCCGCCGGTGGCCGCGGTGGCGCAGCCGGCGCCGCAGCCGCGGCTGGCGACCTTCCTGCGGC
CCGAGATCGCCGAGGGCGCGGTGGTGGTGCGCGACGAGGTCGACCGCAGCGTCGTCACGCTGCGCGGCGA
CGGCCTGTTCGAGCCCGGCAGCGCCACGCTCGCCGCGCCCAAGGAGGCGCTGCTGCGGCGCGTGGCCGAC
GCGCTGGCGCAGTTCGGCGGCGCGGTGCTCGTCACCGGCCACACCGACAGCCAGCCGATCCGCTCGGCGC
GTTTCCCGTCCAACTGGCACCTCTCGCAGGAGCGCGCCGGCGCGGTGCGCGAGCTGCTGGTGAGCCAGCA
GGTGGCCACCGAGCGGGTGCGCGCCGAGGGCCGCGCCGACGGCGAGCCGGTGGTCGCCAATGACAGCGCC
GGCAACCGGGCGCTGAACCGGCGCGTCGAGATCACGCTGTTCGTCGCCGCGCCGCCGGGCGTGGCCACGG
CCGCCAGACCCGCAACCCCCACGGCCACGCCCGCATCCGGAGCCCGGCCATGA