SecReT6
Protein ID: 171060732
SecReT6 ID265
T6SS typei3
Gene symbol-
Locus tagLcho_4064
StrainLeptothrix cholodnii SP-6
Repliconchromosome [GenBank: NC_010524] [Browse all T6SS(s) in this replicon]
Location [Strand]4552514..4554256 [-]
ProductFHA domain-containing protein
NoteFha
UniProt IDB1XWW7
KEGG IDlch:Lcho_4064
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 1.80E-12, Aligned region: 29..96
Protein Sequence: 580 a.a.     [Download]
>gi|171060732|ref|YP_001793081.1| FHA domain-containing protein [Leptothrix cholodnii SP-6]
MTLTLSALSLNDQPLSQPVVAHFDDQGGTIGRGDQNTLALPDPERHISRQHARITAEAKGYRITNLSSAN
AVTVAGRTLGQGESAPIRHRDQVRIGGFLLEARDDSADDLLARTITGGRAATAATADKSGGVRPGGVAGG
GPPPIAAPSPEADPFADFFGPAVVRPAAPRQGAPGPAVAPAADPFAGFTGFGAPAPAPVASHGRPGAASA
GPLAGFSGLGEPGGSIDDLLGPGLGAGAGTGADLDAFLRQPVGAPDAAAAPAAAAPARPSAGASQPDHVP
ALQAAFKAPVWPEPPPEPVTAPTPLLAPTPASARSPAPPPTFAPTLAPATPRPPAPAVAAGTTPSPRGPS
PAWADADDPSAALWRAFCEGADLHLQLPQGLSPELMRVIGQLLRSAVDGTQQMMAIRAATKHELRADVTM
IQARQNNPLKFSPDAQAALEQLLQPPMRGFLPGPAAMTDAMHDLVGHTIGTMAGMRAALEGVLNRFAPTV
LEGKLTTSSVLDTLLPMNRRSRLWELYLQHFEGIRQEAQEDFHTLFGRAFLAAYEQQLDRLHAQHAEHDR
QRPAAPSASSPSSSPPSSPP
 
Nucleotide Sequence: 1743 bp     [Download]
>gi|171056692|ref|NC_010524.1|:c4554256-4552514 Leptothrix cholodnii SP-6 chromosome, complete genome
ATGACCCTCACCCTCAGCGCCCTGTCCCTCAACGACCAGCCCCTGAGCCAGCCGGTGGTGGCGCATTTCG
ACGACCAGGGCGGCACCATCGGGCGCGGCGACCAGAACACGCTGGCGCTGCCCGACCCCGAGCGCCACAT
CTCGCGCCAGCACGCCCGCATCACCGCCGAGGCCAAGGGCTACCGCATCACCAACCTGAGCAGCGCCAAC
GCCGTGACGGTGGCCGGGCGCACGCTGGGCCAGGGCGAATCGGCGCCGATCCGCCACCGCGACCAGGTGC
GCATCGGCGGCTTCCTGCTCGAGGCGCGCGACGACAGCGCCGACGACCTGCTGGCCCGCACCATCACCGG
CGGGCGCGCTGCCACCGCCGCCACGGCCGACAAGTCCGGCGGCGTCCGCCCGGGTGGCGTGGCGGGTGGC
GGGCCGCCGCCGATCGCCGCGCCGAGCCCGGAGGCCGATCCGTTTGCCGACTTCTTCGGCCCGGCGGTGG
TGCGGCCCGCCGCGCCGCGCCAGGGCGCGCCCGGCCCGGCGGTGGCGCCGGCGGCCGATCCGTTCGCCGG
CTTCACCGGCTTCGGTGCGCCCGCTCCTGCGCCCGTCGCCAGCCACGGGCGGCCCGGGGCGGCATCGGCG
GGCCCGCTGGCGGGTTTTTCCGGGCTGGGCGAACCCGGCGGCTCGATCGACGACCTGCTCGGCCCGGGCT
TGGGCGCAGGCGCGGGCACCGGCGCGGATCTCGATGCCTTCCTGCGCCAGCCGGTGGGCGCGCCCGACGC
GGCTGCCGCACCCGCCGCCGCGGCGCCGGCCCGGCCGTCTGCGGGGGCCAGCCAGCCCGACCACGTGCCG
GCCCTGCAGGCCGCGTTCAAGGCACCGGTCTGGCCCGAACCCCCGCCCGAACCCGTGACCGCGCCGACCC
CGCTGCTGGCGCCGACCCCGGCATCGGCTCGTTCACCGGCCCCACCTCCAACCTTTGCGCCGACCCTTGC
GCCCGCCACGCCACGCCCGCCTGCGCCTGCCGTGGCCGCCGGGACCACACCCTCGCCGCGCGGCCCGTCG
CCCGCGTGGGCCGATGCCGACGACCCCAGCGCCGCCCTCTGGCGCGCCTTCTGCGAGGGCGCTGACCTGC
ACCTGCAGTTGCCGCAAGGCCTGTCGCCCGAGCTGATGCGGGTGATCGGCCAGCTGCTGCGCAGCGCGGT
CGACGGCACGCAGCAGATGATGGCGATCCGCGCCGCCACCAAGCACGAGCTGCGCGCCGACGTCACCATG
ATCCAGGCGCGCCAGAACAACCCGCTCAAGTTCTCGCCCGACGCCCAGGCCGCGCTCGAACAGCTGCTGC
AGCCGCCGATGCGCGGCTTCCTGCCCGGCCCGGCGGCCATGACCGACGCCATGCACGACCTGGTCGGCCA
CACCATCGGCACCATGGCCGGCATGCGCGCCGCGCTCGAAGGCGTGCTCAACCGCTTTGCGCCGACGGTG
CTCGAAGGCAAGCTCACCACCAGCTCGGTGCTCGACACCCTGCTGCCGATGAACCGCCGCTCGCGCCTGT
GGGAGCTGTACCTGCAGCATTTCGAGGGCATCCGCCAGGAGGCGCAGGAAGATTTCCACACCCTGTTCGG
CCGCGCCTTCCTGGCCGCCTACGAGCAGCAGCTCGACCGCCTGCACGCCCAGCACGCCGAGCACGACCGC
CAGCGCCCGGCGGCGCCGTCAGCGTCGTCGCCGTCGTCATCCCCCCCGTCGTCGCCGCCGTGA