SecReT6
Protein ID: 171060748
SecReT6 ID265
T6SS typei3
Gene symbol-
Locus tagLcho_4080
StrainLeptothrix cholodnii SP-6
Repliconchromosome [GenBank: NC_010524] [Browse all T6SS(s) in this replicon]
Location [Strand]4571976..4574291 [-]
ProductImpA family type VI secretion-associated protein
NoteTssI
UniProt IDB1XWY3
KEGG IDlch:Lcho_4080
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 3.90E-80, Aligned region: 26..336
Phage_base_V [PF04717], Evalue: 3.80E-28, Aligned region: 106..133
Phage_base_V [PF04717], Evalue: 3.80E-28, Aligned region: 376..469
Gp5_C [PF06715], Evalue: 7.50E-16, Aligned region: 521..540
Gp5_C [PF06715], Evalue: 7.50E-16, Aligned region: 528..551
Gp5_C [PF06715], Evalue: 7.50E-16, Aligned region: 552..575
Gp5_C [PF06715], Evalue: 7.50E-16, Aligned region: 585..607
Gp5_C [PF06715], Evalue: 7.50E-16, Aligned region: 608..631
Gp5_C [PF06715], Evalue: 7.50E-16, Aligned region: 634..655
Gp5_C [PF06715], Evalue: 7.50E-16, Aligned region: 667..687
Gp5_C [PF06715], Evalue: 7.50E-16, Aligned region: 681..702
Gp5_C [PF06715], Evalue: 7.50E-16, Aligned region: 743..751
Protein Sequence: 771 a.a.     [Download]
>gi|171060748|ref|YP_001793097.1| ImpA family type VI secretion-associated protein [Leptothrix cholodnii SP-6]
MANPITVSSPLPAQDLFFESMRYRGGLSTLGELELDLLSPKPGLDPLALLGQPLSVNVTLHDGSQRHFSG
LVSRFGMGRDRPAGAAPTGAAAGQGRYYAYRARVVPWLWFLTRTADCRIFQEQTVPDIVKQVFADHDIAS
FEFKLFRSYRKLGYCVQYRESDFHFVARLLEHEGIYWYVEHGDGAHKLVLVDAMGAHDAAPGCPSLRYTE
DLAQAPPDQEFVTRWRFAEGVKSGKVALTSYDFERPSTPLAVDAVRERDYPHADYEVFDFQGDYIQAADG
SHYADNAADAFQTRFVRHHASANALGVEVGRRLKISKHPRDSINAEYLITDLDVHAQVAEHGAAQAVSRF
DCEFDAIPAEQQFRPMRRARKPSVQGPQTAVVVGPAGEEIFTDKYGRVKVQFHWDRYGQRDEKSSCWVRV
SQPWAGKNFGFMQIPRIGQEVVVDFLEGDPDQPLITGRIYNAEQMPPWDLPANATQSGVLSRSSQGGAYG
NANALRFEDKKGAEQLWLHAEKNQDIEVENDETHWVGHDRSKTVDHDEQVHVKHDRTEVVDHDEQITVHH
DRRERVDNDESIGIGRDRKMLIERDKTETVARDKGIHIGGSHSESVGGSMSVSVAGTLTESVGVNYAETV
GGAMEITVGAVMAITVGGALAETVGGSKSASVGSGKSETIGGSLSVTVAKDVTESISGNRTVTVHKNLTQ
AVKGDQVVEVTKNASVKAKKIQLVADDEISLKTGSAEITMKKNGDITIKGNKITVKGDSDVILKGSKIAE
N
 
Nucleotide Sequence: 2316 bp     [Download]
>gi|171056692|ref|NC_010524.1|:c4574291-4571976 Leptothrix cholodnii SP-6 chromosome, complete genome
ATGGCCAACCCCATCACCGTCAGCAGCCCCTTGCCGGCGCAGGACTTGTTCTTCGAGTCCATGCGCTACC
GCGGCGGCCTGAGCACGCTCGGTGAGCTGGAGCTGGATCTGCTGAGCCCCAAGCCCGGGCTCGATCCGCT
GGCGCTGCTGGGCCAGCCGCTGAGTGTCAACGTCACGTTGCATGACGGCAGCCAGCGCCACTTCAGCGGC
CTGGTCAGCCGCTTCGGCATGGGCCGCGACCGGCCCGCCGGCGCGGCGCCGACGGGTGCCGCGGCCGGCC
AGGGCCGCTACTACGCCTACCGCGCGCGGGTGGTGCCGTGGCTGTGGTTCCTGACCCGCACCGCCGACTG
CCGGATCTTCCAGGAGCAGACGGTGCCCGACATCGTCAAGCAGGTGTTCGCCGACCACGACATCGCGAGC
TTCGAGTTCAAGCTGTTCCGCAGCTATCGCAAGCTCGGCTACTGCGTGCAGTACCGCGAGAGCGATTTCC
ACTTCGTCGCCCGCCTGCTCGAACACGAAGGCATCTACTGGTACGTGGAACACGGCGACGGCGCGCACAA
GCTGGTGCTGGTCGACGCCATGGGCGCGCACGATGCCGCGCCGGGCTGCCCCTCGCTGCGCTACACCGAG
GATCTGGCGCAGGCGCCGCCGGACCAGGAGTTCGTCACCCGCTGGCGTTTTGCCGAGGGCGTCAAGAGCG
GCAAGGTGGCGCTCACCAGCTACGACTTCGAGCGCCCGTCCACGCCGCTGGCGGTCGACGCGGTGCGCGA
GCGCGACTACCCGCACGCCGACTACGAGGTCTTCGATTTCCAGGGCGACTACATCCAGGCCGCCGACGGC
AGCCACTACGCCGACAACGCCGCCGACGCCTTCCAGACCCGCTTCGTGCGCCACCACGCCAGCGCCAACG
CGCTGGGTGTGGAGGTGGGCCGGCGGCTGAAGATCAGCAAGCACCCGCGCGACTCGATCAACGCCGAATA
CCTGATCACCGACCTCGACGTGCACGCGCAGGTGGCCGAACACGGCGCGGCGCAGGCGGTGAGCCGCTTC
GATTGCGAGTTCGACGCGATCCCGGCCGAGCAGCAGTTCCGCCCCATGCGGCGCGCCCGCAAGCCCAGCG
TGCAGGGGCCGCAGACCGCGGTGGTGGTGGGGCCGGCCGGCGAGGAGATCTTCACCGACAAGTACGGCCG
CGTGAAGGTGCAGTTCCATTGGGACCGTTACGGCCAGCGCGACGAGAAGAGCAGTTGCTGGGTGCGCGTC
AGCCAGCCCTGGGCCGGCAAGAACTTCGGCTTCATGCAGATCCCGCGCATCGGCCAGGAGGTGGTGGTCG
ACTTTCTGGAGGGCGACCCGGATCAGCCGCTGATCACCGGCCGCATCTACAACGCCGAGCAGATGCCGCC
GTGGGATCTGCCGGCCAACGCCACGCAGAGCGGCGTGCTGAGCCGCTCGTCGCAAGGCGGTGCCTACGGC
AATGCCAATGCACTGCGCTTCGAGGACAAGAAGGGGGCCGAGCAGCTCTGGCTGCACGCCGAGAAGAACC
AGGACATCGAGGTCGAGAACGACGAGACGCATTGGGTCGGGCATGACCGCAGCAAGACCGTCGACCACGA
CGAGCAGGTGCACGTCAAGCATGACCGCACCGAGGTGGTCGACCACGACGAACAGATCACCGTTCACCAC
GACCGCAGGGAACGTGTCGACAACGACGAGTCGATCGGCATCGGCCGTGACCGCAAGATGCTGATCGAGC
GCGACAAGACCGAGACGGTCGCGCGCGACAAGGGCATCCACATCGGCGGCAGCCACTCCGAGAGCGTGGG
CGGCTCGATGAGCGTCTCGGTGGCGGGCACGCTGACCGAGTCGGTGGGCGTGAACTACGCCGAGACCGTG
GGTGGCGCCATGGAAATCACCGTGGGCGCGGTGATGGCCATCACCGTGGGTGGGGCCCTCGCCGAGACGG
TGGGGGGATCCAAGTCGGCGTCGGTGGGCTCGGGCAAGTCAGAAACCATCGGCGGCAGCCTGTCGGTGAC
GGTCGCCAAGGATGTCACCGAGTCGATCTCGGGCAACCGGACCGTGACCGTCCACAAGAACCTTACGCAA
GCGGTCAAGGGCGATCAGGTGGTCGAGGTCACCAAGAACGCGTCGGTCAAGGCCAAGAAGATCCAGCTCG
TGGCCGACGACGAGATCAGCTTGAAGACCGGCAGCGCCGAGATCACGATGAAGAAGAACGGCGACATCAC
CATCAAGGGCAACAAGATCACCGTCAAGGGCGACAGCGACGTCATCCTCAAGGGCAGCAAGATCGCGGAG
AACTGA