SecReT6
Protein ID: 171060752
SecReT6 ID265
T6SS typei3
Gene symbol-
Locus tagLcho_4084
StrainLeptothrix cholodnii SP-6
Repliconchromosome [GenBank: NC_010524] [Browse all T6SS(s) in this replicon]
Location [Strand]4577943..4580693 [-]
Producttype VI secretion ATPase
NoteTssH
UniProt IDB1XWY7
KEGG IDlch:Lcho_4084
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 7.40E-40, Aligned region: 231..251
AAA_2 [PF07724], Evalue: 7.40E-40, Aligned region: 637..803
AAA [PF00004], Evalue: 7.40E-18, Aligned region: 231..363
AAA [PF00004], Evalue: 7.40E-18, Aligned region: 643..771
ClpB_D2-small [PF10431], Evalue: 4.00E-14, Aligned region: 810..884
AAA_5 [PF07728], Evalue: 3.10E-12, Aligned region: 231..251
AAA_5 [PF07728], Evalue: 3.10E-12, Aligned region: 642..754
AAA_16 [PF13191], Evalue: 1.90E-09, Aligned region: 35..98
AAA_16 [PF13191], Evalue: 1.90E-09, Aligned region: 144..188
AAA_16 [PF13191], Evalue: 1.90E-09, Aligned region: 208..254
AAA_16 [PF13191], Evalue: 1.90E-09, Aligned region: 275..309
AAA_16 [PF13191], Evalue: 1.90E-09, Aligned region: 486..486
AAA_16 [PF13191], Evalue: 1.90E-09, Aligned region: 633..683
AAA_16 [PF13191], Evalue: 1.90E-09, Aligned region: 707..727
Sigma54_activat [PF00158], Evalue: 7.10E-07, Aligned region: 210..255
Sigma54_activat [PF00158], Evalue: 7.10E-07, Aligned region: 641..760
Clp_N [PF02861], Evalue: 8.10E-06, Aligned region: 28..75
Clp_N [PF02861], Evalue: 8.10E-06, Aligned region: 110..131
Zeta_toxin [PF06414], Evalue: 2.40E-05, Aligned region: 230..253
Zeta_toxin [PF06414], Evalue: 2.40E-05, Aligned region: 641..682
AAA_22 [PF13401], Evalue: 4.70E-05, Aligned region: 40..80
AAA_22 [PF13401], Evalue: 4.70E-05, Aligned region: 230..309
AAA_22 [PF13401], Evalue: 4.70E-05, Aligned region: 368..397
AAA_22 [PF13401], Evalue: 4.70E-05, Aligned region: 640..664
AAA_22 [PF13401], Evalue: 4.70E-05, Aligned region: 704..727
AAA_17 [PF13207], Evalue: 5.10E-05, Aligned region: 231..251
AAA_17 [PF13207], Evalue: 5.10E-05, Aligned region: 642..680
NACHT [PF05729], Evalue: 5.50E-05, Aligned region: 231..259
NACHT [PF05729], Evalue: 5.50E-05, Aligned region: 643..669
AAA_19 [PF13245], Evalue: 6.40E-05, Aligned region: 228..254
AAA_19 [PF13245], Evalue: 6.40E-05, Aligned region: 640..665
Arch_ATPase [PF01637], Evalue: 8.30E-05, Aligned region: 209..251
Arch_ATPase [PF01637], Evalue: 8.30E-05, Aligned region: 282..383
Arch_ATPase [PF01637], Evalue: 8.30E-05, Aligned region: 643..686
AAA_14 [PF13173], Evalue: 0.00015, Aligned region: 231..311
AAA_14 [PF13173], Evalue: 0.00015, Aligned region: 337..397
AAA_14 [PF13173], Evalue: 0.00015, Aligned region: 641..723
AAA_25 [PF13481], Evalue: 0.0004, Aligned region: 226..306
AAA_25 [PF13481], Evalue: 0.0004, Aligned region: 357..398
AAA_25 [PF13481], Evalue: 0.0004, Aligned region: 483..504
AAA_25 [PF13481], Evalue: 0.0004, Aligned region: 640..668
IstB_IS21 [PF01695], Evalue: 0.0011, Aligned region: 224..253
IstB_IS21 [PF01695], Evalue: 0.0011, Aligned region: 642..662
AAA_18 [PF13238], Evalue: 0.0013, Aligned region: 231..254
AAA_18 [PF13238], Evalue: 0.0013, Aligned region: 644..672
SRP54 [PF00448], Evalue: 0.0023, Aligned region: 231..269
SRP54 [PF00448], Evalue: 0.0023, Aligned region: 641..677
AAA_29 [PF13555], Evalue: 0.0089, Aligned region: 223..246
AAA_29 [PF13555], Evalue: 0.0089, Aligned region: 640..667
Protein Sequence: 916 a.a.     [Download]
>gi|171060752|ref|YP_001793101.1| type VI secretion ATPase [Leptothrix cholodnii SP-6]
MTEISRTALFGKLDPLAYKAIEGATVFCKMRGNPYVELQHWLAQILNTPDSDLHRIIRHYELDSAALAAD
LTRSLDRLPRGASSISDFSTFVLDAVERAWIYGSLMFGERQIRTGHLLIGLLKTPSLRNVLLSISKQFER
VKLDDLADRFASLLAASPEQSQGASDSGAAPGEASDAIPPAAMGKQEALKRFTTDLTEQARAGKMDPIVG
RDDEIRQVVDILMRRRQNNPILVGEAGVGKTAVVEGFAQRIARGDVPPALKEVQLLALDVGLLQAGASMK
GEFEQRLRSVIEEVQASPKPIILFVDETHTLVGAGGAAGTGDAANLLKPALARGTLRTVGATTFAEYKKY
IEKDPALTRRFQSVQVDEPDEKRAILMMRGVASTMEKHHQVQILDEALEAAVKLSHRYIPARQLPDKSVS
LLDTACARVAVSLHATPAEVDDTRKRIEALETELGIIGRERAIGIDVLEREADASRLLADERERLALLDQ
RWAEEKTLVDELLALRAKLRGGVRPVEGTGSELEAAVAPVAEGVAEPGLSEGERADALARLREVQAQLAT
LQGESPLILPTVDYQAVASVVGDWTGIPVGRMARNEIDTVLKLPTLLAQRVIGQDHAMEMIAKRIQTSRA
GLDNPGKPIGVFMLAGTSGVGKTETALALAEALYGGEQNLIVINMSEYQEAHTVSSLKGAPPGYVGYGEG
GVLTEAVRRKPYSVVLLDEVEKAHPDVHELFFQVFDKGFMEDGEGRVIDFKNTLILLTTNAGTELISALC
RDPARMPDPEGMAKALRQPLLEIFPPALLGRLVAIPYYPLSDEMLGRIVKLQLERIRKRVETRYKIPFEY
GDDVVELVVSRCTESESGGRMIDAILTNTMLPDISREFLNRMLDGTPIERVEVQVSEGNFAYGFGPDTAA
PARDEP
 
Nucleotide Sequence: 2751 bp     [Download]
>gi|171056692|ref|NC_010524.1|:c4580693-4577943 Leptothrix cholodnii SP-6 chromosome, complete genome
ATGACCGAGATCTCCCGCACGGCCCTGTTCGGCAAGCTCGACCCGCTGGCCTACAAGGCGATCGAAGGCG
CCACGGTGTTCTGCAAGATGCGCGGCAATCCCTACGTCGAGCTGCAGCACTGGCTGGCGCAGATCCTCAA
CACGCCCGATTCCGACCTGCACCGCATCATTCGCCACTACGAGCTCGACAGCGCCGCGCTCGCCGCCGAC
CTGACGCGCTCGCTCGACCGCCTGCCGCGCGGCGCCTCGTCGATCTCGGACTTCTCGACCTTCGTGCTCG
ATGCGGTCGAGCGGGCCTGGATCTACGGCTCGCTGATGTTCGGCGAACGCCAGATCCGCACCGGCCACCT
GCTGATCGGGCTGCTCAAGACGCCGTCGCTGCGCAACGTGCTGCTGTCGATCTCGAAGCAGTTCGAGCGC
GTCAAGCTCGATGACCTGGCCGACCGATTCGCCAGCCTGCTGGCGGCGTCGCCCGAGCAGTCGCAAGGCG
CCAGCGACAGCGGTGCCGCACCCGGCGAGGCCAGCGACGCGATCCCGCCCGCGGCGATGGGCAAGCAGGA
GGCGCTCAAGCGCTTCACCACCGACCTCACCGAGCAGGCGCGCGCCGGCAAGATGGACCCGATCGTCGGC
CGCGACGACGAGATCCGCCAGGTGGTCGACATCCTGATGCGCAGGCGCCAGAACAACCCGATCCTGGTCG
GCGAGGCCGGTGTCGGCAAGACCGCGGTGGTGGAAGGTTTCGCCCAGCGCATCGCCCGCGGCGACGTGCC
GCCGGCGCTGAAGGAGGTGCAGCTGCTCGCGCTCGACGTCGGCCTGCTGCAGGCGGGGGCGAGCATGAAG
GGCGAGTTCGAGCAGCGCCTGCGTTCGGTGATCGAGGAGGTGCAGGCGAGCCCGAAGCCGATCATCCTGT
TCGTCGACGAGACCCACACGCTGGTCGGCGCCGGTGGCGCGGCCGGCACGGGGGACGCGGCCAACCTGCT
CAAGCCCGCGCTGGCCCGCGGCACGCTGCGCACGGTGGGCGCCACCACCTTTGCCGAGTACAAGAAATAC
ATCGAGAAGGACCCGGCGCTGACGCGGCGTTTCCAGAGCGTGCAGGTCGACGAGCCGGATGAAAAACGCG
CCATCCTGATGATGCGCGGCGTCGCCAGCACGATGGAAAAGCACCACCAGGTGCAGATCCTCGACGAGGC
GCTGGAGGCCGCCGTCAAGTTGAGCCACCGCTACATCCCGGCGCGCCAGCTGCCCGACAAGAGCGTCAGC
CTGCTCGACACCGCCTGCGCCCGCGTGGCGGTGAGCCTGCACGCGACGCCGGCCGAGGTCGACGACACGC
GCAAGCGCATCGAGGCGCTCGAGACCGAGCTCGGCATCATCGGCCGCGAGCGCGCCATCGGCATCGACGT
GCTGGAACGCGAGGCCGATGCATCGCGCCTGCTGGCCGATGAACGCGAGCGCCTGGCCCTGCTCGACCAG
CGCTGGGCCGAAGAGAAGACGCTGGTCGACGAGCTGCTCGCCCTGCGCGCGAAGCTGCGTGGCGGCGTGC
GGCCGGTCGAAGGCACCGGCAGCGAACTCGAAGCGGCGGTGGCGCCGGTGGCCGAGGGGGTCGCCGAGCC
GGGTCTGAGCGAGGGCGAGCGCGCCGACGCGCTGGCCCGCCTGCGCGAGGTGCAGGCGCAGCTCGCCACG
CTGCAAGGCGAGAGCCCGCTGATCCTGCCCACGGTCGACTACCAGGCGGTGGCCAGCGTGGTCGGCGACT
GGACCGGCATCCCGGTCGGCCGCATGGCGCGCAACGAGATCGACACCGTGCTCAAGCTGCCCACGCTGCT
GGCCCAGCGCGTGATCGGCCAGGACCACGCGATGGAGATGATCGCCAAGCGCATCCAGACCTCGCGCGCC
GGCCTCGACAACCCGGGCAAGCCGATCGGCGTCTTCATGCTCGCCGGCACTTCGGGCGTCGGCAAGACCG
AAACCGCGCTGGCGCTGGCCGAGGCGCTCTACGGCGGCGAGCAGAACCTCATCGTCATCAACATGAGCGA
GTACCAGGAGGCTCACACCGTGAGCTCGCTCAAAGGCGCGCCACCCGGCTACGTCGGCTATGGCGAAGGG
GGCGTGCTGACCGAGGCGGTGCGCCGCAAGCCCTACAGCGTGGTGCTGCTCGACGAGGTCGAGAAGGCCC
ACCCGGATGTGCACGAGCTGTTCTTCCAGGTCTTCGACAAGGGCTTCATGGAAGACGGCGAAGGCCGCGT
GATCGACTTCAAGAACACCCTGATCCTGCTGACCACCAACGCCGGCACCGAGCTGATCTCGGCGCTGTGC
CGCGACCCCGCGCGCATGCCCGACCCGGAGGGCATGGCGAAGGCGCTGCGCCAGCCGCTGCTGGAGATCT
TTCCGCCCGCGCTGCTCGGCCGGCTGGTGGCGATCCCGTATTACCCGCTCAGCGACGAGATGCTCGGGCG
CATCGTCAAGCTGCAGCTGGAGCGCATCCGCAAGCGGGTGGAGACGCGCTACAAGATCCCGTTCGAGTAT
GGCGACGACGTGGTCGAGCTGGTGGTCAGCCGCTGCACCGAGAGCGAGTCGGGCGGGCGGATGATCGACG
CGATCCTGACCAACACGATGCTGCCGGACATCAGCCGCGAGTTCCTGAATCGCATGCTCGATGGCACGCC
GATCGAGCGGGTGGAGGTGCAGGTCAGCGAAGGCAATTTCGCCTACGGCTTCGGGCCCGACACGGCCGCG
CCCGCACGCGATGAACCCTGA