SecReT6
Protein ID: 171060753
SecReT6 ID265
T6SS typei3
Gene symbol-
Locus tagLcho_4085
StrainLeptothrix cholodnii SP-6
Repliconchromosome [GenBank: NC_010524] [Browse all T6SS(s) in this replicon]
Location [Strand]4580698..4581831 [-]
Producttype VI secretion protein
NoteTssG
UniProt IDB1XWY8
KEGG IDlch:Lcho_4085
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 3.70E-107, Aligned region: 36..345
Protein Sequence: 377 a.a.     [Download]
>gi|171060753|ref|YP_001793102.1| type VI secretion protein [Leptothrix cholodnii SP-6]
MAPQSPDPTDLAGAAAQTPAERARAHQQLLGALAVQPWRHDFFQLLRWVEALHPQAPRLGRAARPRDEPL
RIGQDPELSFAPAALHSYREQTGAPPRIGQRFFGLFGPMGPLPLHLSEYVRERARSLGDATPLAFADIFQ
HRASLLFYRAWAQAQPVSHLDRPGDDAFGRWLASLAGLGDPSMRERDHVHDHAKRLHVGTLARGPRNAEG
LVRIVGQYFKVPVRIEPHVGHWLDLERSERLVLSRGGRAATGRLGLSAAAGSRVWDRQSRFRLHLGPLGL
AQYERFLPGQPALLALRDWLRLYTGLGLACELKLVLAGREVPEARLGGHRGGGAAARLGRSSWLGVRRVP
ADRPPPRDRADLAFLVEPVRSCTDASR
 
Nucleotide Sequence: 1134 bp     [Download]
>gi|171056692|ref|NC_010524.1|:c4581831-4580698 Leptothrix cholodnii SP-6 chromosome, complete genome
ATGGCCCCGCAATCACCCGATCCCACCGACCTGGCCGGCGCTGCCGCGCAGACGCCGGCCGAGCGTGCGC
GGGCCCACCAGCAGTTGCTCGGCGCGCTGGCGGTGCAGCCGTGGCGACACGATTTCTTCCAGCTGCTGCG
CTGGGTCGAGGCCCTGCATCCGCAGGCGCCGCGGCTGGGTCGGGCGGCGCGCCCGCGTGACGAGCCGCTG
CGCATCGGCCAGGATCCGGAGCTGTCGTTCGCGCCCGCGGCGCTGCACAGCTATCGCGAACAGACGGGCG
CGCCGCCGCGCATCGGCCAGCGCTTCTTCGGCCTGTTCGGCCCGATGGGCCCGTTGCCGCTGCACCTGAG
CGAATACGTGCGCGAGCGTGCCCGCAGCCTGGGCGACGCCACGCCGCTGGCCTTTGCCGACATCTTCCAG
CACCGCGCCAGCCTGCTGTTCTACCGGGCCTGGGCACAGGCTCAGCCGGTGAGCCACCTCGACCGGCCGG
GCGACGATGCCTTCGGCCGCTGGCTGGCGTCGCTGGCCGGGCTGGGCGATCCGTCGATGCGCGAGCGCGA
CCACGTGCACGACCACGCCAAGCGCCTGCACGTGGGCACGCTGGCGCGCGGCCCGCGCAATGCCGAGGGG
CTGGTGCGCATCGTCGGCCAGTACTTCAAGGTGCCGGTGCGCATCGAGCCGCACGTCGGCCACTGGCTCG
ATCTCGAGCGCAGCGAGCGCCTGGTGCTGTCGCGCGGCGGGCGGGCTGCGACCGGGCGACTGGGCCTGAG
CGCGGCGGCGGGCTCGCGGGTGTGGGATCGGCAGAGCCGTTTCCGGCTGCACCTGGGGCCGCTCGGCCTG
GCGCAGTACGAGCGTTTCCTGCCCGGCCAGCCGGCCCTGCTGGCGCTGCGCGACTGGCTGCGGCTCTACA
CCGGCCTGGGCCTGGCGTGCGAGCTCAAGCTGGTGCTGGCGGGCCGCGAGGTGCCCGAGGCGCGGCTGGG
CGGGCACCGCGGCGGCGGCGCTGCCGCGCGGCTGGGCCGCAGCAGCTGGCTCGGCGTGCGGCGCGTGCCC
GCCGATCGACCGCCGCCGCGCGACCGCGCCGACCTCGCCTTCCTGGTCGAGCCTGTCCGTTCCTGCACCG
ATGCATCGAGGTGA