SecReT6
Protein ID: 171060754
SecReT6 ID265
T6SS typei3
Gene symbol-
Locus tagLcho_4086
StrainLeptothrix cholodnii SP-6
Repliconchromosome [GenBank: NC_010524] [Browse all T6SS(s) in this replicon]
Location [Strand]4581857..4583773 [-]
Producttype VI secretion protein
NoteTssF
UniProt IDB1XWY9
KEGG IDlch:Lcho_4086
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 3.00E-180, Aligned region: 9..638
Protein Sequence: 638 a.a.     [Download]
>gi|171060754|ref|YP_001793103.1| type VI secretion protein [Leptothrix cholodnii SP-6]
MSRGLDPGLLRHYNEELAYLREMGLEFSRQFPKIAARLGMDGLEVADPYVERLLEGFAFMSARVQLKLDA
EYPRFIGHLLESVYPNALAPVPSMAVMRLQPDLADPALARGAPVPRGSALHADQLRSQNTRCEFRTAHAL
RLWPIEIASVQYFSHAGELPVARLPELRQAAGGLRIRLRAHGGLRFDQLPIDSLVFYLAAPDEVAYRLHA
LIFGAGLGSWLAAPAANAPVPGSAARPVDPGPAGAGWRGADSLQPLGHSDDEALLPVTARGFSGHRLVQE
LAALPQRFLFVEVAELRARLARLAVTEVDLFLPFSRGEPGLEALVDASSLALNCTPAINLFGKRLDRIQT
SVSNWEYHVVPDRTRPLDYELHSLASVVGHGTGRVAEQAFAPLYTACHDEGPEQLAYYSLRREVRLPSTR
QQEQGARSSYLGSEVFVSLVDPHNLPYAEDVRQLSLTGLVSNRDLPMLLSGSGWTLDLPGPVRGATCLRG
PTAPHARLPRGDIGWQLISQLTLNHLSIAGEDPQRAAASLRSLLIHHGSADDAGWRKQVEGLRAVSAQPV
TRRLPMPGPLAYGLGVAIDVTVDELAFQGGSAFLMGCVLERFLARQASINSFTQLRLIAPGRGTLMTWPP
RVGSAAVI
 
Nucleotide Sequence: 1917 bp     [Download]
>gi|171056692|ref|NC_010524.1|:c4583773-4581857 Leptothrix cholodnii SP-6 chromosome, complete genome
ATGAGCCGCGGCCTCGATCCCGGCCTGCTGCGCCACTACAACGAGGAGCTCGCCTACCTGCGCGAGATGG
GGCTGGAGTTCTCGCGCCAGTTCCCGAAGATCGCCGCCCGGCTCGGCATGGACGGGCTCGAGGTGGCCGA
CCCCTACGTCGAACGCCTGCTCGAAGGTTTCGCCTTCATGAGCGCGCGGGTGCAGTTGAAGCTCGACGCC
GAGTACCCGCGCTTCATCGGCCACCTGCTCGAAAGCGTCTATCCGAACGCGCTGGCGCCGGTGCCGTCGA
TGGCGGTGATGCGGCTGCAGCCCGATCTGGCCGACCCGGCGCTGGCTCGCGGCGCGCCGGTGCCACGGGG
CAGCGCGCTGCATGCCGATCAGCTGCGCAGCCAGAACACGCGCTGCGAGTTCCGCACCGCGCATGCGCTG
CGGCTGTGGCCGATCGAGATCGCATCGGTGCAGTACTTCAGCCACGCCGGCGAGCTGCCGGTGGCGCGCC
TGCCCGAGCTGCGGCAGGCGGCCGGCGGCCTGCGCATCCGCCTGCGGGCGCACGGCGGGCTGCGCTTCGA
CCAGCTGCCGATCGACTCGCTGGTGTTCTACCTGGCCGCGCCCGACGAGGTCGCGTACCGGCTGCACGCG
CTGATTTTCGGTGCCGGGCTGGGCAGCTGGCTGGCTGCGCCGGCCGCCAACGCCCCGGTCCCTGGCAGCG
CCGCGCGCCCGGTCGACCCCGGCCCGGCCGGCGCCGGGTGGCGCGGCGCCGATTCGCTGCAGCCCCTCGG
TCATTCGGATGACGAGGCGCTGCTGCCCGTCACCGCGCGCGGCTTCTCCGGCCACCGGCTGGTGCAGGAG
CTGGCCGCGCTGCCGCAGCGGTTCCTGTTCGTCGAGGTGGCCGAGCTGCGCGCGCGGCTGGCCCGGCTGG
CGGTCACCGAGGTCGACCTGTTCCTGCCCTTCAGCCGCGGCGAACCGGGCCTGGAGGCGCTGGTCGACGC
CAGCAGCCTGGCGCTCAACTGCACGCCGGCGATCAACCTGTTCGGCAAGCGCCTCGACCGCATCCAGACC
AGCGTGTCGAACTGGGAATACCACGTCGTGCCCGACCGCACACGCCCGCTCGACTACGAGCTGCACAGCC
TGGCGAGCGTCGTCGGCCACGGCACCGGCCGGGTCGCCGAGCAGGCCTTCGCGCCGCTCTACACCGCCTG
CCACGACGAGGGCCCGGAGCAGCTCGCCTACTACAGCCTGCGCCGCGAGGTGCGCCTGCCGTCGACGCGC
CAGCAGGAGCAGGGTGCGCGCTCGTCCTACCTCGGCAGCGAGGTGTTCGTGTCGCTGGTCGACCCGCACA
ACCTGCCGTATGCCGAAGATGTGCGCCAGCTCTCGCTCACCGGTCTGGTCAGCAACCGCGACCTGCCGAT
GCTGCTGTCGGGCAGCGGCTGGACGCTCGACCTGCCCGGCCCCGTGCGCGGCGCCACCTGCCTGCGCGGG
CCGACCGCACCGCACGCCCGCCTGCCACGCGGCGACATCGGCTGGCAGCTCATCAGCCAGCTCACGCTCA
ATCACCTGAGCATCGCGGGCGAGGATCCGCAACGCGCCGCCGCATCGCTGCGCAGCCTGCTGATCCACCA
CGGCTCGGCCGACGACGCCGGCTGGCGCAAGCAGGTCGAGGGCCTGCGCGCGGTCTCGGCGCAGCCGGTG
ACGCGGCGCCTGCCGATGCCCGGGCCGCTGGCCTACGGGCTGGGCGTGGCGATCGACGTGACGGTCGACG
AGCTCGCCTTCCAGGGCGGCAGCGCCTTCCTGATGGGCTGCGTGCTGGAGCGTTTCCTGGCCCGCCAGGC
GTCGATCAACAGCTTCACGCAATTGCGGCTGATCGCGCCCGGGCGCGGCACGCTGATGACCTGGCCGCCG
CGCGTGGGCAGCGCCGCGGTGATCTGA