SecReT6
Protein ID: 171060755
SecReT6 ID265
T6SS typei3
Gene symbol-
Locus tagLcho_4087
StrainLeptothrix cholodnii SP-6
Repliconchromosome [GenBank: NC_010524] [Browse all T6SS(s) in this replicon]
Location [Strand]4583770..4584324 [-]
Producttype VI secretion system lysozyme-like protein
NoteTssE
UniProt IDB1XWZ0
KEGG IDlch:Lcho_4087
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 3.20E-19, Aligned region: 36..146
Protein Sequence: 184 a.a.     [Download]
>gi|171060755|ref|YP_001793104.1| type VI secretion system lysozyme-like protein [Leptothrix cholodnii SP-6]
MALQPLRERLQPALLDRLSDDDPASAVEADERRFMSKAQLRAAVLRDLGWLFNAVQPLGGGAAETWPQAG
ASVLNFGLPPVSGQLASKIDVSQIERELRRAILRYEPRILEHDLRVQAIESDSLLDSHNIIEFEISGWLW
AQPVPLELLLRTRFDLEAGQVAVHERSAVSVSAAAGAAPREAAQ
 
Nucleotide Sequence: 555 bp     [Download]
>gi|171056692|ref|NC_010524.1|:c4584324-4583770 Leptothrix cholodnii SP-6 chromosome, complete genome
ATGGCCCTGCAACCCCTGCGCGAGCGCCTCCAGCCGGCCCTGCTCGACCGCCTGAGCGACGACGATCCCG
CCAGCGCGGTCGAGGCCGACGAGCGCCGTTTCATGTCGAAGGCGCAGCTGCGTGCCGCGGTGCTGCGCGA
CCTCGGCTGGCTGTTCAACGCGGTGCAGCCGCTCGGCGGCGGCGCGGCCGAGACCTGGCCGCAGGCCGGT
GCGTCGGTGCTCAATTTCGGCCTGCCGCCGGTGTCGGGGCAGCTGGCGTCGAAGATCGACGTGAGCCAGA
TCGAGCGCGAGCTGCGCCGGGCCATCCTGCGCTACGAGCCGCGCATCCTCGAACACGACCTGCGCGTGCA
GGCGATCGAATCCGACAGCCTGCTCGACAGCCACAACATCATCGAGTTCGAGATCAGCGGCTGGCTGTGG
GCGCAGCCGGTGCCGCTGGAGCTGCTGCTGCGCACGCGCTTCGACCTCGAGGCCGGCCAGGTGGCGGTGC
ACGAGCGCAGTGCCGTCAGCGTGTCGGCCGCTGCAGGCGCTGCGCCGCGGGAGGCTGCCCAATGA