SecReT6
Protein ID: 171060756
SecReT6 ID265
T6SS typei3
Gene symbol-
Locus tagLcho_4088
StrainLeptothrix cholodnii SP-6
Repliconchromosome [GenBank: NC_010524] [Browse all T6SS(s) in this replicon]
Location [Strand]4584347..4584871 [-]
ProductHcp1 family type VI secretion system effector
NoteTssD
UniProt IDB1XXM1
KEGG IDlch:Lcho_4088
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.80E-26, Aligned region: 7..152
Protein Sequence: 174 a.a.     [Download]
>gi|171060756|ref|YP_001793105.1| Hcp1 family type VI secretion system effector [Leptothrix cholodnii SP-6]
MALADMFLRVEGGKQGLIKGEVVQPDHLNEIEVTGWSWGMDGSSTAFGQASARTSLQELVIHKRVDSAST
ALMSALRNNEVIKKAVLSVRKAGGGAAVEYFHITIEKARLVSHRVGSAGAPGAHAPLGAGAASGPELHEE
VRFAFWKVQVEYRPQDPTGGGRGVSTFETEVQQA
 
Nucleotide Sequence: 525 bp     [Download]
>gi|171056692|ref|NC_010524.1|:c4584871-4584347 Leptothrix cholodnii SP-6 chromosome, complete genome
ATGGCGCTGGCCGACATGTTCCTGCGCGTCGAAGGCGGCAAGCAGGGCCTCATCAAGGGCGAGGTGGTGC
AGCCCGATCACCTCAACGAGATCGAGGTCACCGGCTGGTCGTGGGGCATGGACGGCAGCAGCACGGCCTT
CGGCCAGGCCAGCGCGCGCACCAGCCTGCAGGAACTGGTGATCCACAAGCGCGTCGACAGCGCGAGCACC
GCGCTGATGTCCGCGCTGCGCAACAACGAGGTCATCAAGAAGGCGGTGCTGTCGGTGCGCAAGGCCGGCG
GCGGCGCGGCGGTGGAGTACTTCCACATCACGATCGAGAAGGCCCGGCTGGTGTCGCACCGCGTCGGCAG
CGCCGGCGCCCCGGGCGCACACGCACCGCTGGGCGCCGGGGCCGCGAGCGGCCCCGAGCTGCACGAGGAA
GTGCGCTTCGCGTTCTGGAAGGTGCAGGTCGAATACCGCCCGCAGGATCCGACCGGCGGCGGGCGCGGCG
TCTCGACCTTCGAGACCGAAGTGCAGCAGGCCTGA