SecReT6
Protein ID: 171060758
SecReT6 ID265
T6SS typei3
Gene symbol-
Locus tagLcho_4090
StrainLeptothrix cholodnii SP-6
Repliconchromosome [GenBank: NC_010524] [Browse all T6SS(s) in this replicon]
Location [Strand]4585545..4587041 [-]
ProductEvpB family type VI secretion protein
NoteTssC
UniProt IDB1XXM3
KEGG IDlch:Lcho_4090
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 2.20E-195, Aligned region: 67..493
Protein Sequence: 498 a.a.     [Download]
>gi|171060758|ref|YP_001793107.1| EvpB family type VI secretion protein [Leptothrix cholodnii SP-6]
MATETSPGGAALQGVAFEGGDFAALLDREFKPKTDEAKSAVEQAVMTLAQQALAQTTLIGSDVIGSIEAL
IAALDAKLSAQVNAILHHDDFQKLESAWRGLHHLVNNTETDEMLMIRVMNISKNELGKTLKRYKGTAWDQ
SPIFKKIYEEEYGQFGGAPYGCLVGDYYFDQSAPDVELLGEISKISASAHAPFIAAANPALMQMGSWQEL
ANPRDLTKIFTTPEYAAWRSLRESDDARYIGLAMPRFLARAPYGAKTNPVEEFDFEEDTANADHSKYTWA
NSAYAMAVNINRAFKEYGWCSRIRGIESGGAVEGLPTHTFPTDDGGVDMKCPTEIAISDRREAELAKNGF
MPLVHKKNSDLAAFIGAQSLQKPAEYDDPDATANANLAARLPYLFACSRFAHYLKCIVRDKIGSFKERDE
IQRWLQDWIMNYVDGDPAHSSEETKSRRPLAAAEVVVAEDESNPGYYTSKIFLRPHYQLEGLTVSLRLVS
KLPSQKSA
 
Nucleotide Sequence: 1497 bp     [Download]
>gi|171056692|ref|NC_010524.1|:c4587041-4585545 Leptothrix cholodnii SP-6 chromosome, complete genome
ATGGCCACTGAAACCTCCCCCGGCGGTGCCGCGCTGCAAGGTGTCGCCTTCGAAGGCGGCGACTTCGCCG
CGCTGCTCGACCGCGAATTCAAGCCCAAGACCGACGAGGCCAAGAGCGCCGTCGAACAGGCGGTGATGAC
GCTGGCGCAGCAGGCGCTGGCGCAGACCACGCTGATCGGCAGCGACGTGATCGGCTCGATCGAGGCGCTG
ATCGCCGCACTCGACGCCAAGCTCAGCGCGCAGGTCAACGCGATCCTGCACCACGACGACTTCCAGAAGC
TCGAGAGCGCCTGGCGCGGCCTGCACCACCTCGTCAACAACACCGAGACCGACGAGATGCTGATGATCCG
GGTGATGAACATCTCGAAGAACGAGCTGGGCAAGACCCTCAAGCGCTACAAGGGCACGGCCTGGGACCAG
AGCCCCATCTTCAAGAAGATCTACGAAGAGGAATACGGCCAGTTCGGCGGCGCGCCGTATGGCTGCCTGG
TGGGCGACTACTACTTCGACCAGAGCGCGCCCGATGTCGAGCTGCTGGGCGAGATCAGCAAGATCTCGGC
CTCGGCCCACGCCCCGTTCATCGCCGCCGCCAACCCCGCGCTGATGCAGATGGGCTCGTGGCAGGAACTG
GCCAATCCGCGCGACCTGACCAAGATCTTCACCACACCCGAATACGCCGCCTGGCGCTCGTTGCGCGAGT
CCGACGACGCACGCTACATCGGCCTGGCGATGCCGCGTTTCCTGGCCCGCGCGCCGTATGGCGCCAAGAC
CAATCCGGTCGAGGAGTTCGACTTCGAGGAAGACACCGCCAACGCCGACCACAGCAAGTACACCTGGGCC
AATTCGGCCTACGCGATGGCGGTCAACATCAACCGCGCGTTCAAGGAATACGGCTGGTGCTCGCGCATCC
GCGGCATCGAGTCGGGTGGCGCGGTCGAGGGCCTGCCCACGCACACCTTCCCGACCGACGACGGCGGCGT
CGACATGAAGTGCCCGACCGAGATCGCCATCAGCGACCGCCGCGAGGCCGAGCTGGCCAAGAACGGCTTC
ATGCCGCTGGTGCACAAGAAGAACTCGGACCTGGCCGCCTTCATCGGCGCGCAGTCGCTGCAGAAGCCGG
CCGAATACGACGACCCCGACGCCACCGCCAATGCCAACCTGGCCGCGCGCCTGCCGTATCTGTTTGCCTG
CAGCCGCTTTGCGCACTACCTGAAATGCATCGTGCGCGACAAGATCGGCTCGTTCAAGGAACGCGACGAG
ATCCAGCGCTGGCTGCAGGACTGGATCATGAACTACGTCGACGGCGACCCGGCCCATTCGTCCGAAGAGA
CCAAGTCGCGCCGCCCGTTGGCGGCCGCCGAGGTGGTGGTGGCCGAGGACGAGAGCAACCCCGGCTACTA
CACCTCGAAGATCTTCCTGCGCCCGCACTACCAGCTCGAAGGGCTGACGGTGTCGCTGCGGCTGGTGTCC
AAGCTGCCGTCGCAGAAATCGGCCTGA