SecReT6
Protein ID: 171060759
SecReT6 ID265
T6SS typei3
Gene symbol-
Locus tagLcho_4091
StrainLeptothrix cholodnii SP-6
Repliconchromosome [GenBank: NC_010524] [Browse all T6SS(s) in this replicon]
Location [Strand]4587063..4587569 [-]
Producttype VI secretion protein
NoteTssB
UniProt IDB1XXM4
KEGG IDlch:Lcho_4091
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 2.80E-60, Aligned region: 9..162
Protein Sequence: 168 a.a.     [Download]
>gi|171060759|ref|YP_001793108.1| type VI secretion protein [Leptothrix cholodnii SP-6]
MATSSQKFIARNRAPRVQIEYDVETYGAEKKVQVPFVMGVLADLSGKPAEPLAPVADRKFLEIDVDNFNS
RMKSMKPRVAFQVANELTGEGNLAVDISFETLDDFSPAAVARKVEGLRQLLEARQQLSNLITYMDGKTGA
EELLAKVIKDQALLQSLTQAAKPAGTPE
 
Nucleotide Sequence: 507 bp     [Download]
>gi|171056692|ref|NC_010524.1|:c4587569-4587063 Leptothrix cholodnii SP-6 chromosome, complete genome
ATGGCCACCAGCAGCCAGAAATTCATCGCCCGCAATCGCGCCCCGCGGGTGCAGATCGAATACGACGTCG
AGACCTACGGCGCCGAGAAGAAGGTGCAGGTGCCGTTCGTGATGGGCGTGCTGGCCGACCTGAGCGGCAA
GCCGGCCGAGCCGCTGGCGCCGGTGGCGGATCGCAAGTTCCTCGAGATCGACGTCGACAACTTCAACTCG
CGCATGAAGTCGATGAAGCCGCGGGTGGCCTTCCAGGTCGCCAACGAGCTGACCGGCGAGGGCAACCTGG
CGGTCGACATCAGCTTCGAGACGCTCGACGACTTCTCGCCCGCGGCGGTGGCGCGCAAGGTCGAGGGGCT
GCGCCAGCTGCTCGAGGCGCGCCAGCAGCTGTCGAACCTGATCACCTACATGGACGGCAAGACCGGCGCC
GAGGAGCTGCTGGCCAAGGTCATCAAGGACCAGGCGCTGCTGCAGTCGCTGACCCAGGCGGCCAAGCCGG
CCGGCACCCCCGAATGA