SecReT6
Protein ID: 171060760
SecReT6 ID265
T6SS typei3
Gene symbol-
Locus tagLcho_4092
StrainLeptothrix cholodnii SP-6
Repliconchromosome [GenBank: NC_010524] [Browse all T6SS(s) in this replicon]
Location [Strand]4587619..4588656 [-]
ProductImpA family type VI secretion-associated protein
NoteTssA
UniProt IDB1XXM5
KEGG IDlch:Lcho_4092
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 3.90E-19, Aligned region: 55..115
Protein Sequence: 345 a.a.     [Download]
>gi|171060760|ref|YP_001793109.1| ImpA family type VI secretion-associated protein [Leptothrix cholodnii SP-6]
MSDVDIEALLTPLDAAAPCGADLEYDESFRAMEEALRGKPEQQYGDTVIAAEGSDWRRVMSLALALGARS
RDLRVAVNLLRARLHLEGLQACGSGLALIHGLLDRHWPHLHPMLDADDGNDPTMRLNALAPLVDPGAVLA
DLRTATLGGPRSGISGRSFELVAGKALPREGENVLGADAFVQALRELEARQPGCVEALRHVAATTDAIDA
LLVAQVGTEGPDLKPLQQYTQMLSRWAGKALASQPAAAGDVAVDAAVDADPDAAPAAAGAAAAAAPGGAI
RNREDAIRQLQRVCEWIELNEPSNPVPLLLRRAQRLMRKSFIDIIRDLVPDGVGAVEHLAGPADP
 
Nucleotide Sequence: 1038 bp     [Download]
>gi|171056692|ref|NC_010524.1|:c4588656-4587619 Leptothrix cholodnii SP-6 chromosome, complete genome
ATGTCCGACGTCGACATCGAGGCACTGCTGACACCGCTGGACGCCGCCGCGCCCTGCGGCGCCGACCTCG
AATACGACGAGTCCTTCCGCGCGATGGAAGAGGCGCTGCGCGGCAAGCCCGAGCAGCAGTACGGCGACAC
CGTGATCGCCGCCGAAGGCAGCGACTGGCGCCGCGTGATGTCGCTCGCGCTCGCGCTCGGCGCCCGCAGC
CGCGACCTGCGGGTGGCCGTCAACCTGCTGCGCGCGCGCCTGCACCTCGAAGGACTTCAGGCCTGCGGCA
GCGGCCTGGCGCTGATCCACGGCCTGCTCGATCGCCACTGGCCGCACCTGCACCCGATGCTCGATGCCGA
CGACGGCAACGACCCGACGATGCGCCTGAACGCGCTGGCGCCGCTGGTCGATCCCGGCGCCGTGCTGGCC
GATCTGCGCACGGCCACGCTGGGCGGCCCGCGCAGCGGCATCAGCGGGCGCAGCTTCGAGCTGGTGGCCG
GCAAGGCGCTGCCGCGCGAGGGCGAGAACGTGCTCGGCGCCGATGCCTTCGTGCAGGCCCTGCGCGAGCT
GGAAGCCCGCCAGCCCGGCTGCGTCGAGGCGCTGCGCCATGTGGCCGCCACCACCGATGCGATCGATGCG
CTGCTGGTCGCGCAGGTCGGCACCGAAGGCCCCGATCTCAAGCCGTTGCAGCAGTACACGCAGATGCTGT
CTCGCTGGGCGGGGAAGGCGCTGGCGTCGCAGCCCGCTGCGGCCGGCGACGTTGCGGTGGACGCTGCCGT
GGACGCCGATCCCGACGCCGCACCGGCCGCTGCCGGCGCGGCAGCCGCGGCGGCGCCCGGCGGCGCCATC
CGCAACCGCGAGGACGCCATCCGCCAGCTGCAGCGGGTGTGCGAGTGGATCGAGCTCAACGAGCCGTCCA
ACCCGGTGCCGCTGCTGCTGCGCCGCGCCCAGCGGCTGATGCGCAAGAGCTTCATCGACATCATCCGCGA
CCTCGTGCCCGACGGTGTCGGCGCGGTCGAGCACCTGGCCGGGCCGGCCGACCCGTGA