SecReT6
Protein ID: 172062048
SecReT6 ID269
T6SS typei3
Gene symbol-
Locus tagBamMC406_3008
StrainBurkholderia ambifaria MC40-6
Repliconchromosome I [GenBank: NC_010551] [Browse all T6SS(s) in this replicon]
Location [Strand]3329037..3331700 [-]
Producttype VI secretion ATPase
NoteTssH
UniProt IDB1YPS0
KEGG IDbac:BamMC406_3008
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 4.30E-38, Aligned region: 231..311
AAA_2 [PF07724], Evalue: 4.30E-38, Aligned region: 468..516
AAA_2 [PF07724], Evalue: 4.30E-38, Aligned region: 610..776
AAA [PF00004], Evalue: 6.30E-21, Aligned region: 233..364
AAA [PF00004], Evalue: 6.30E-21, Aligned region: 615..699
ClpB_D2-small [PF10431], Evalue: 3.20E-14, Aligned region: 782..856
AAA_5 [PF07728], Evalue: 4.80E-14, Aligned region: 233..256
AAA_5 [PF07728], Evalue: 4.80E-14, Aligned region: 614..732
AAA_16 [PF13191], Evalue: 9.40E-10, Aligned region: 32..78
AAA_16 [PF13191], Evalue: 9.40E-10, Aligned region: 210..253
AAA_16 [PF13191], Evalue: 9.40E-10, Aligned region: 274..311
AAA_16 [PF13191], Evalue: 9.40E-10, Aligned region: 375..399
AAA_16 [PF13191], Evalue: 9.40E-10, Aligned region: 484..521
AAA_16 [PF13191], Evalue: 9.40E-10, Aligned region: 611..657
AAA_16 [PF13191], Evalue: 9.40E-10, Aligned region: 679..698
Sigma54_activat [PF00158], Evalue: 1.80E-08, Aligned region: 229..313
Sigma54_activat [PF00158], Evalue: 1.80E-08, Aligned region: 613..713
AAA_22 [PF13401], Evalue: 3.10E-08, Aligned region: 233..314
AAA_22 [PF13401], Evalue: 3.10E-08, Aligned region: 366..401
AAA_22 [PF13401], Evalue: 3.10E-08, Aligned region: 613..637
AAA_22 [PF13401], Evalue: 3.10E-08, Aligned region: 676..702
AAA_19 [PF13245], Evalue: 2.70E-07, Aligned region: 231..254
AAA_19 [PF13245], Evalue: 2.70E-07, Aligned region: 612..636
AAA_17 [PF13207], Evalue: 1.30E-05, Aligned region: 46..70
AAA_17 [PF13207], Evalue: 1.30E-05, Aligned region: 233..272
AAA_17 [PF13207], Evalue: 1.30E-05, Aligned region: 614..652
AAA_18 [PF13238], Evalue: 2.90E-05, Aligned region: 233..284
AAA_18 [PF13238], Evalue: 2.90E-05, Aligned region: 616..647
IstB_IS21 [PF01695], Evalue: 4.80E-05, Aligned region: 225..256
IstB_IS21 [PF01695], Evalue: 4.80E-05, Aligned region: 614..634
IstB_IS21 [PF01695], Evalue: 4.80E-05, Aligned region: 723..748
AAA_25 [PF13481], Evalue: 6.00E-05, Aligned region: 233..273
AAA_25 [PF13481], Evalue: 6.00E-05, Aligned region: 612..640
Clp_N [PF02861], Evalue: 0.00011, Aligned region: 27..74
AAA_29 [PF13555], Evalue: 0.00016, Aligned region: 225..251
AAA_29 [PF13555], Evalue: 0.00016, Aligned region: 612..639
AAA_14 [PF13173], Evalue: 0.00017, Aligned region: 233..313
AAA_14 [PF13173], Evalue: 0.00017, Aligned region: 613..701
Zeta_toxin [PF06414], Evalue: 0.00025, Aligned region: 233..252
Zeta_toxin [PF06414], Evalue: 0.00025, Aligned region: 484..512
Zeta_toxin [PF06414], Evalue: 0.00025, Aligned region: 605..654
NACHT [PF05729], Evalue: 0.0015, Aligned region: 233..261
NACHT [PF05729], Evalue: 0.0015, Aligned region: 614..641
DEAD [PF00270], Evalue: 0.0039, Aligned region: 221..255
DEAD [PF00270], Evalue: 0.0039, Aligned region: 614..792
RNA_helicase [PF00910], Evalue: 0.0076, Aligned region: 234..254
RNA_helicase [PF00910], Evalue: 0.0076, Aligned region: 615..636
DUF853 [PF05872], Evalue: 0.0083, Aligned region: 226..306
DUF853 [PF05872], Evalue: 0.0083, Aligned region: 615..635
RuvB_N [PF05496], Evalue: 0.0097, Aligned region: 231..252
RuvB_N [PF05496], Evalue: 0.0097, Aligned region: 304..313
RuvB_N [PF05496], Evalue: 0.0097, Aligned region: 576..635
RuvB_N [PF05496], Evalue: 0.0097, Aligned region: 683..707
Protein Sequence: 887 a.a.     [Download]
>gi|172062048|ref|YP_001809700.1| type VI secretion ATPase [Burkholderia ambifaria MC40-6]
MTISRQALFGKLGHSLFRSVESATTFCKLRGNPYVELVHWLHQLLQAPDGDLQRIIRHCDIDAEALDRDV
LRALAALPAGASSISDFSHHIETAVERAWVLASLDFGDRRIRGAWLVAALVKTPELRRVLLSISPAFGKI
PLESLGEMLPAWIDGSPEAADAPYDGTDFGGAVPGEAAGALAPAAGGGSPLEQYCSDLTARARAGEIDPV
VGRELEIRTMIDVLLRRRQNNPLLTGEAGVGKTAVVECLARAIVDGDVPPKLADVRLLSLDVGALLAGAS
MKGEFEARLKGVLEAATKSAVPVILFVDEIHTLIGAGGQAGTGDAANLLKPALARGTLRTIGATTWAEYK
RHIEKDPALTRRFQVLQVPEPEEAAAIDMVRGLARTFSRHHGVVVLDEAIRAAVTLSHRYIPSRQLPDKA
ISLLDTACARVALSQHAPPRELQNVRQRLLAAQVECDLLDQERSIGLGDTDALARTQARIAELEREAANV
EARWRAQADAAQALLSARETARDAASGVPADRLQVLERALAEQQGETAFVFPEVNEAIVAAIVSDWTGIP
VRRMVTDEVAAVRTLPDTLAARVIGQPDALQQIGERVQTARAGLTDPKKPLGVFMLAGPSGVGKTETALA
LAEALYGGEQNLITINMSEYQEAHTVSGLKGAPPGYVGYGEGGVLTEAVRRRPYSVVLLDEIEKAHADVH
EMFFQVFDKGYMEDGDGRYIDFRNTTILLTSNAGSDLITSLCSDEALAPRTDALCAALGPALLKTFPAAF
LGRVTVVPYRPLAQATLARIVRLHLDRVVTRMADGHGVAFGYAPAVLDYIVERCLVQETGARLLIGFIEQ
HVLPRLAAQWLDALAAKRTLTRVDLELVDAGAVPADAFMFRASYADD
 
Nucleotide Sequence: 2664 bp     [Download]
>gi|172059067|ref|NC_010551.1|:c3331700-3329037 Burkholderia ambifaria MC40-6 chromosome 1, complete sequence
ATGACAATTTCAAGGCAGGCCTTATTCGGCAAACTCGGGCATTCGCTGTTCCGAAGCGTCGAATCCGCCA
CGACTTTCTGCAAGCTGCGCGGCAACCCTTACGTCGAACTGGTGCATTGGCTGCATCAACTGCTGCAGGC
GCCCGACGGCGACCTCCAGCGGATCATCCGGCATTGCGACATCGACGCCGAGGCACTCGATCGGGACGTG
CTGCGCGCGCTCGCCGCGCTGCCGGCCGGTGCGAGTTCGATCAGCGACTTCTCGCACCATATCGAAACGG
CCGTCGAGCGCGCGTGGGTGCTGGCCTCCCTGGATTTCGGCGACCGCCGCATTCGCGGCGCATGGCTCGT
CGCCGCGCTCGTCAAGACGCCCGAACTGCGCCGCGTGCTGCTGTCGATCTCTCCGGCGTTCGGCAAGATC
CCGCTGGAAAGCCTGGGCGAGATGCTGCCCGCGTGGATCGACGGCTCGCCGGAGGCGGCGGATGCGCCGT
ATGACGGCACCGACTTCGGTGGCGCGGTGCCCGGCGAGGCCGCGGGCGCGCTGGCGCCGGCAGCCGGTGG
CGGCTCGCCGCTCGAGCAGTACTGCAGCGATTTGACTGCGCGCGCGCGGGCGGGCGAGATTGATCCGGTC
GTCGGCCGCGAGCTCGAGATCCGCACGATGATCGATGTGCTGTTGCGCAGGCGTCAAAACAATCCGCTGC
TGACCGGCGAGGCCGGGGTCGGCAAGACGGCCGTGGTCGAATGTCTGGCCCGCGCGATCGTCGACGGCGA
CGTGCCGCCGAAGCTGGCCGACGTGCGCCTGTTGAGTCTCGACGTCGGCGCACTGCTTGCCGGCGCGAGC
ATGAAGGGCGAATTCGAGGCGCGTCTGAAGGGCGTGCTCGAGGCGGCGACGAAGTCGGCGGTGCCCGTCA
TCCTGTTCGTCGATGAAATCCATACGCTGATCGGCGCCGGCGGCCAGGCCGGCACCGGCGATGCGGCGAA
CCTGCTGAAGCCGGCGCTCGCACGCGGTACGCTGCGGACGATCGGCGCGACGACCTGGGCCGAATACAAG
CGCCATATCGAAAAGGACCCGGCGCTGACGCGGCGCTTCCAGGTGCTCCAGGTGCCGGAGCCCGAGGAAG
CGGCGGCGATCGACATGGTGCGCGGGCTCGCGCGCACCTTCTCGCGACATCACGGCGTCGTCGTGCTCGA
CGAAGCGATTCGCGCGGCGGTGACGCTGTCGCATCGGTACATTCCGTCACGGCAACTACCCGACAAGGCG
ATCAGTCTGCTCGACACCGCTTGCGCGCGCGTGGCGCTGTCGCAGCACGCGCCGCCGCGCGAGTTGCAGA
ACGTGCGCCAGCGCCTGCTGGCGGCGCAAGTCGAATGCGATCTGCTCGACCAGGAGCGATCCATCGGCCT
GGGCGACACGGACGCGCTGGCCCGCACACAGGCGCGCATCGCCGAGCTGGAACGCGAGGCGGCGAACGTC
GAGGCGCGTTGGCGCGCGCAGGCCGACGCCGCGCAAGCGCTGTTGAGCGCACGCGAGACCGCACGCGACG
CCGCCTCCGGCGTGCCGGCCGACCGGCTGCAGGTGCTCGAGCGCGCGCTCGCGGAGCAGCAGGGCGAGAC
GGCGTTCGTGTTCCCTGAAGTGAACGAAGCGATCGTCGCGGCGATCGTGTCCGACTGGACCGGCATTCCG
GTGCGCCGGATGGTCACCGACGAGGTCGCCGCGGTGCGCACGCTGCCTGACACGCTCGCGGCGCGCGTCA
TCGGCCAGCCGGACGCGCTGCAGCAGATCGGCGAGCGCGTGCAGACTGCGCGCGCAGGGCTCACGGATCC
GAAAAAACCGCTCGGCGTATTCATGCTGGCCGGTCCGTCGGGCGTCGGCAAGACCGAGACGGCGCTGGCG
CTGGCCGAGGCGCTGTACGGCGGGGAGCAGAACCTGATCACGATCAACATGAGCGAGTATCAGGAAGCTC
ACACCGTGTCTGGGCTCAAGGGGGCGCCGCCCGGCTATGTCGGTTACGGCGAGGGCGGCGTCCTGACCGA
GGCGGTGCGGCGCCGGCCCTACTCGGTGGTGCTGCTCGACGAGATCGAGAAGGCACATGCCGACGTGCAC
GAAATGTTCTTCCAGGTGTTCGACAAGGGGTATATGGAGGACGGCGACGGACGCTACATCGATTTCCGCA
ACACCACGATTCTGCTGACCAGCAACGCGGGCTCCGACCTGATCACGAGCCTCTGCTCGGACGAGGCGCT
CGCGCCTCGCACGGATGCGCTGTGCGCGGCGCTCGGGCCGGCGTTGCTCAAGACGTTCCCGGCCGCGTTT
CTCGGCCGCGTGACCGTGGTGCCGTACAGGCCGCTCGCGCAGGCGACGCTGGCGCGGATCGTGCGGCTGC
ATCTGGATCGTGTGGTGACCCGCATGGCCGACGGGCACGGTGTGGCGTTCGGCTATGCGCCGGCGGTGCT
CGACTACATCGTCGAACGCTGCCTTGTCCAGGAAACGGGCGCGCGCCTGTTGATCGGCTTCATCGAGCAG
CACGTGCTGCCGCGGCTCGCCGCGCAGTGGCTGGATGCGCTGGCGGCGAAGCGTACGCTCACGCGGGTCG
ACCTCGAACTGGTCGATGCGGGCGCGGTGCCTGCCGACGCCTTCATGTTCCGCGCGTCGTACGCGGACGA
CTGA