SecReT6
Protein ID: 172062050
SecReT6 ID269
T6SS typei3
Gene symbol-
Locus tagBamMC406_3010
StrainBurkholderia ambifaria MC40-6
Repliconchromosome I [GenBank: NC_010551] [Browse all T6SS(s) in this replicon]
Location [Strand]3333225..3334079 [+]
Productvirulence protein SciE type
NoteTagJ
UniProt IDB1YPS2
KEGG IDbac:BamMC406_3010
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 1.40E-47, Aligned region: 154..274
Protein Sequence: 284 a.a.     [Download]
>gi|172062050|ref|YP_001809702.1| virulence protein SciE type [Burkholderia ambifaria MC40-6]
MNAPDTTTPATGRPAVQNLLQTQSLDALKEQTIEAVRQRPSDPSERWLLFQLLCVDGDWERALKQLQTWA
TLEPEGTARAQLHRGLIEGEMFRTEVFAGTRTPGFVDEATPAWIDQLLQANVRLGAGDVAGADALREAAL
DAAPASRGESAEMGDFAWLTDSDTRLGPVCEMVVAGGYRWIPFARIKSLTLTPIGTLTDLVWRPATLILR
DATVLRGYVPTRYPGSEHGPAAVRLARETRWQDIGETNVIALGQKTWTTNCGDWGLLDIGGCRFTDEDAD
GTSS
 
Nucleotide Sequence: 855 bp     [Download]
>gi|172059067|ref|NC_010551.1|:3333225-3334079 Burkholderia ambifaria MC40-6 chromosome 1, complete sequence
ATGAACGCCCCTGATACCACCACGCCAGCCACTGGCCGCCCAGCAGTGCAGAACCTGCTGCAGACCCAGT
CGCTCGACGCGCTGAAAGAGCAAACCATCGAAGCGGTGCGTCAGCGGCCGTCCGACCCGTCCGAACGCTG
GCTGCTGTTCCAGCTGCTGTGCGTCGACGGCGACTGGGAACGCGCGCTCAAGCAGTTGCAGACCTGGGCA
ACATTGGAGCCCGAAGGCACTGCACGCGCGCAGCTGCATCGCGGCCTCATCGAAGGCGAGATGTTCCGCA
CGGAGGTATTCGCCGGCACGCGCACTCCCGGCTTCGTCGACGAAGCCACGCCCGCGTGGATCGACCAGTT
GCTGCAGGCGAATGTCCGGCTCGGCGCCGGCGACGTGGCGGGCGCCGACGCGCTGCGCGAGGCCGCGCTC
GACGCGGCGCCAGCCAGTCGAGGCGAAAGCGCCGAAATGGGTGACTTCGCATGGCTGACCGACAGCGACA
CGCGACTCGGCCCCGTCTGCGAAATGGTCGTTGCAGGCGGTTACCGGTGGATTCCGTTCGCCCGCATCAA
GTCGCTCACGCTCACCCCGATCGGCACGCTGACCGATCTCGTATGGCGGCCTGCCACGCTGATCCTGCGC
GATGCCACGGTTCTCAGGGGGTACGTGCCGACCCGCTACCCGGGCTCGGAGCATGGTCCCGCCGCCGTCC
GGCTCGCGCGCGAAACCCGCTGGCAGGACATCGGCGAAACGAACGTGATCGCACTCGGACAAAAAACCTG
GACGACCAACTGCGGCGACTGGGGCCTGCTGGATATCGGCGGCTGCCGCTTCACCGATGAAGACGCAGAT
GGCACGTCATCCTGA