SecReT6
Protein ID: 172062051
SecReT6 ID269
T6SS typei3
Gene symbol-
Locus tagBamMC406_3011
StrainBurkholderia ambifaria MC40-6
Repliconchromosome I [GenBank: NC_010551] [Browse all T6SS(s) in this replicon]
Location [Strand]3334063..3334584 [+]
Producttype VI secretion system lysozyme-like protein
NoteTssE
UniProt IDB1YPS3
KEGG IDbac:BamMC406_3011
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 5.60E-18, Aligned region: 6..24
GPW_gp25 [PF04965], Evalue: 5.60E-18, Aligned region: 42..148
Protein Sequence: 173 a.a.     [Download]
>gi|172062051|ref|YP_001809703.1| type VI secretion system lysozyme-like protein [Burkholderia ambifaria MC40-6]
MARHPEDQHRPAYLPSLLDRLQDDAPHARHEVARAYAPSGEGMRRIIQRDLALLLNATNLDGELDSARYP
QAAASVVNYGVPPLSGSYLSDRNWETIETLVKTAIVRFEPRLLPDSIAIRPLAGREAASYNKLAFEIRGL
MQWSPYPLEFLIQSTFDIESNKVTLDPGARIEH
 
Nucleotide Sequence: 522 bp     [Download]
>gi|172059067|ref|NC_010551.1|:3334063-3334584 Burkholderia ambifaria MC40-6 chromosome 1, complete sequence
ATGGCACGTCATCCTGAAGATCAGCACCGGCCCGCGTACCTGCCGTCCTTGCTCGACCGGCTGCAGGACG
ACGCGCCGCACGCTCGCCATGAAGTCGCGCGCGCGTATGCACCGAGCGGCGAAGGCATGCGCCGGATCAT
CCAACGCGACCTCGCGCTGCTACTCAACGCGACCAACCTCGACGGCGAGCTCGACTCCGCACGGTACCCG
CAGGCCGCCGCGTCCGTCGTCAACTACGGCGTGCCGCCGTTGTCGGGAAGCTACCTGAGCGACCGGAACT
GGGAAACGATCGAGACACTCGTCAAGACCGCGATCGTCCGTTTCGAACCCCGCCTGCTCCCCGATTCGAT
CGCGATCCGGCCCCTCGCAGGGCGCGAAGCCGCCAGTTACAACAAGCTGGCATTCGAGATTCGCGGGCTG
ATGCAATGGTCGCCGTACCCCCTCGAGTTCCTGATTCAAAGCACCTTCGATATCGAATCGAACAAGGTGA
CGCTCGATCCGGGCGCTCGCATCGAACATTGA