SecReT6
Protein ID: 172062052
SecReT6 ID269
T6SS typei3
Gene symbol-
Locus tagBamMC406_3012
StrainBurkholderia ambifaria MC40-6
Repliconchromosome I [GenBank: NC_010551] [Browse all T6SS(s) in this replicon]
Location [Strand]3334586..3336466 [+]
Producttype VI secretion protein
NoteTssF
UniProt IDB1YPS4
KEGG IDbac:BamMC406_3012
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 2.80E-211, Aligned region: 5..624
Protein Sequence: 626 a.a.     [Download]
>gi|172062052|ref|YP_001809704.1| type VI secretion protein [Burkholderia ambifaria MC40-6]
MDPRFLDHYNRELTYMRELSAEFAAQHPKIARRLGMHGIETADPYVERMIEAFCFMSARTQLKLDAEFPR
FTQRLLEVVYPNYVAPTPSMAVAKLRPSLREGNFSKGFTVPRHSVLRSSIPPGERTACEFRSGHEITLWP
IEIVDAKLTAVPPDLPDLQRMLMPHMRLRGALRLRLRTVGEIKFSQISGLDRLSLYIGGDERIASHLFEL
VHAGGIASVVRAHGATRDDCTFVPKNPVDFEGLRPDQSLLPQMWNTFHGHNLLHEYFTCRQRFYFFVLTQ
LQAGLSKIDGNEAEIVLLLDRLPDELTAHVDASSFQLFCTPIINLFPRRTDRIEINRALTAFHLIPDRSR
PLDYEVFSVSRVFGQKAETSTEVTFNPLYQTLHSDIGNYGRYFSILREPRAMSANARKYGTRSEYVGTEV
FVSLVDQAEAPYDDAIRYLSVDAWLTNRDLPRLIPRNGFSDLTMQDSVPIEGVSLVHPPSTPREPYATGE
TAWRLIRQLSFNYMPLAELDHRDGGQALRNMLRLFVGTSEHEQRTQIESLVGARTEPVVRRLPGHGLLVY
GRGVRCELTVDESGFSGVSPYLFGLVLEQYLARHVSINVFTETELRSMQRGVVTRWKPRMGGRGAV
 
Nucleotide Sequence: 1881 bp     [Download]
>gi|172059067|ref|NC_010551.1|:3334586-3336466 Burkholderia ambifaria MC40-6 chromosome 1, complete sequence
ATGGATCCCAGATTTCTCGACCACTACAATCGCGAACTGACCTACATGCGCGAGCTGTCGGCGGAGTTCG
CCGCACAGCATCCGAAGATCGCCCGCCGGCTCGGCATGCACGGCATCGAAACGGCCGATCCTTACGTGGA
GCGGATGATCGAAGCGTTCTGCTTCATGTCGGCGCGTACGCAGCTCAAGCTCGACGCCGAATTCCCGCGC
TTTACGCAACGCCTGCTCGAGGTCGTGTATCCGAACTACGTTGCGCCGACGCCGTCGATGGCCGTGGCGA
AGCTACGCCCGAGCCTGCGCGAAGGCAACTTCAGCAAGGGCTTCACGGTGCCGCGCCACAGCGTATTGCG
CTCGTCGATCCCACCAGGCGAACGGACCGCCTGCGAGTTTCGCAGCGGTCATGAAATCACGCTTTGGCCG
ATCGAGATCGTCGACGCGAAGCTGACCGCCGTGCCGCCGGACCTTCCCGACCTGCAGCGCATGCTGATGC
CACACATGCGGCTGCGCGGCGCGCTTCGGTTGCGGCTGCGCACGGTCGGCGAAATCAAGTTCTCGCAGAT
CAGCGGGCTCGACCGGCTGTCGCTCTATATCGGCGGCGACGAGCGGATCGCGTCGCATCTGTTCGAACTG
GTCCATGCCGGCGGCATCGCGTCGGTCGTGCGCGCACACGGCGCTACCCGCGACGATTGCACGTTCGTCC
CGAAGAATCCGGTCGATTTCGAGGGCCTGCGCCCCGACCAGAGCCTGTTGCCGCAAATGTGGAATACGTT
CCACGGGCACAATCTGCTGCACGAGTACTTCACTTGTCGGCAGCGCTTCTATTTCTTCGTGCTTACGCAG
TTGCAGGCCGGCCTTTCGAAGATCGACGGCAACGAAGCGGAAATCGTGCTACTGCTCGACCGACTGCCGG
ACGAGCTGACGGCCCACGTCGATGCGTCGAGCTTTCAGTTGTTCTGCACGCCGATCATCAACCTGTTTCC
GCGACGCACCGACCGGATCGAGATCAATCGGGCGCTGACCGCGTTCCACCTGATTCCGGACCGCAGCCGC
CCACTCGACTATGAAGTCTTCTCGGTATCGCGGGTATTCGGCCAGAAAGCCGAAACGTCGACCGAAGTGA
CGTTCAATCCGCTGTACCAGACGCTACACAGTGATATCGGCAATTACGGGCGTTACTTTTCGATTCTGCG
CGAGCCGCGCGCGATGTCGGCCAACGCGCGCAAATACGGCACCCGCAGCGAGTACGTCGGCACCGAAGTA
TTCGTGTCGCTCGTCGATCAGGCCGAAGCGCCCTACGACGACGCGATCCGCTATCTGTCCGTCGACGCGT
GGCTCACCAACCGCGACCTGCCGCGCCTGATTCCGCGCAACGGGTTCAGCGACCTCACGATGCAGGACTC
CGTGCCGATCGAAGGCGTGAGTCTCGTGCATCCGCCAAGCACGCCGCGCGAGCCGTACGCGACCGGCGAA
ACCGCATGGCGGCTGATTCGCCAGTTGAGCTTCAACTACATGCCGCTCGCGGAGCTCGATCATCGCGACG
GCGGCCAGGCCCTGCGCAACATGCTGCGACTGTTCGTCGGAACGAGCGAACACGAACAGCGCACGCAGAT
CGAGAGCCTCGTCGGCGCGCGCACCGAACCGGTCGTTCGACGCCTGCCCGGCCACGGGTTGCTCGTCTAC
GGGCGCGGCGTACGCTGCGAACTGACCGTCGACGAGAGCGGCTTCTCCGGTGTGAGCCCCTATTTGTTCG
GCCTTGTGCTCGAGCAGTACCTGGCGCGACACGTATCGATCAACGTCTTTACCGAGACGGAACTGCGCTC
GATGCAACGCGGCGTCGTGACACGCTGGAAGCCGCGCATGGGCGGACGGGGAGCGGTGTAA