SecReT6
Protein ID: 172062053
SecReT6 ID269
T6SS typei3
Gene symbol-
Locus tagBamMC406_3013
StrainBurkholderia ambifaria MC40-6
Repliconchromosome I [GenBank: NC_010551] [Browse all T6SS(s) in this replicon]
Location [Strand]3336470..3337531 [+]
Producttype VI secretion protein
NoteTssG
UniProt IDB1YPS5
KEGG IDbac:BamMC406_3013
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 8.30E-101, Aligned region: 27..328
Protein Sequence: 353 a.a.     [Download]
>gi|172062053|ref|YP_001809705.1| type VI secretion protein [Burkholderia ambifaria MC40-6]
MDTFDSTPVDDRSPLHPDSLRVWFDERTPWQAGFLSLLRTISARDATQPLPGTARLPRQEPFRVGQQPSM
AFAPREVAALDVQGGRLDVRLFGLGLWGPQGPLPLHMTELAYSRAESHQDKTLIAFANLFHHRALTLFYR
AWASAQATVSLDRPSQETFSFYIGSLMGTDPAEAACTHPPPHARYAASAHLVREARNPDGLAATLSHYFG
VPVAVDEFVSHWIQIAGPERCLLGAPAPSTIMGEGALLGDMIPDCQHKFRLVIGPLDLDQYLRLTPHGDD
LPTLVDWVRAFVGLEYDWEIKLLVKPRAAPPARADSSHRLGYSTWLGESMDDEPVVGMVFEPEKYCDQLE
NPA
 
Nucleotide Sequence: 1062 bp     [Download]
>gi|172059067|ref|NC_010551.1|:3336470-3337531 Burkholderia ambifaria MC40-6 chromosome 1, complete sequence
ATGGATACATTCGACTCGACGCCCGTCGACGACCGCTCGCCGCTGCACCCTGACTCGCTGCGCGTGTGGT
TCGACGAGCGCACGCCGTGGCAGGCGGGTTTCCTGAGCCTGCTGCGCACGATCAGCGCGCGCGATGCAAC
CCAGCCGCTGCCCGGCACGGCACGCCTGCCGAGGCAGGAGCCTTTTCGCGTCGGCCAGCAACCGTCGATG
GCGTTCGCGCCGCGCGAAGTCGCGGCGCTCGACGTGCAGGGCGGCCGGCTGGACGTCCGGCTCTTCGGGC
TCGGACTGTGGGGGCCGCAGGGCCCGCTGCCGCTTCACATGACGGAACTGGCGTATAGCCGTGCGGAGAG
CCATCAGGACAAGACGCTCATTGCATTCGCCAATCTGTTTCATCACCGGGCGCTCACGCTGTTCTACCGG
GCGTGGGCATCCGCACAAGCGACCGTCTCGCTCGACCGGCCGTCGCAGGAGACGTTCTCGTTCTATATCG
GCAGCCTGATGGGCACCGATCCGGCCGAAGCCGCGTGTACGCACCCGCCTCCGCATGCGCGCTATGCGGC
CTCGGCGCACCTGGTGCGCGAGGCACGCAATCCGGACGGCCTGGCCGCGACGCTGTCCCATTACTTCGGC
GTACCTGTGGCCGTCGACGAATTCGTGTCGCACTGGATTCAGATCGCCGGCCCCGAGCGCTGCCTGCTCG
GCGCGCCCGCACCGTCGACGATCATGGGCGAGGGTGCGCTGCTGGGTGACATGATCCCCGATTGCCAGCA
CAAGTTCCGTCTCGTGATCGGGCCGCTCGATCTCGACCAGTACCTGCGTCTGACACCGCATGGCGATGAT
CTGCCGACGCTGGTCGACTGGGTCCGCGCGTTCGTCGGTCTCGAATATGACTGGGAAATCAAGCTGCTCG
TCAAGCCGCGCGCCGCACCGCCCGCGCGCGCCGACAGCTCTCACCGGCTGGGCTATTCGACCTGGCTCGG
GGAATCCATGGACGACGAACCGGTCGTCGGCATGGTGTTCGAGCCCGAGAAATACTGCGATCAACTGGAG
AACCCAGCATGA