SecReT6
Protein ID: 172062054
SecReT6 ID269
T6SS typei3
Gene symbol-
Locus tagBamMC406_3014
StrainBurkholderia ambifaria MC40-6
Repliconchromosome I [GenBank: NC_010551] [Browse all T6SS(s) in this replicon]
Location [Strand]3337528..3338586 [+]
ProductImpA domain-containing protein
NoteTssA
UniProt IDB1YPS6
KEGG IDbac:BamMC406_3014
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 4.80E-21, Aligned region: 61..120
Protein Sequence: 352 a.a.     [Download]
>gi|172062054|ref|YP_001809706.1| ImpA domain-containing protein [Burkholderia ambifaria MC40-6]
MNAPTPDALARYIDLLEPVSAEDPCGPDLEYDPAFVMLQAAVAPRPDAQYGDFVDAPQQANWAEAERDCR
ALLLRTKDLRLLTILIRCRIRQSGAEGLRDGVAVLLQMLERYGEALHPTPMLDGERDPIVYSNAIAALAD
ADAALADARDIRLPKTAGLQLQLRDIEKAFAVPRAKDALAPESASRLLSELWNRRDAAIVALADAQRAVA
EIVALTHDTLQADAPDLDGVVKLLQPFAQTALDAGRAPTAAGPSDAPAEPASASDATASLPIEATPREAD
APAPSARAPRPMDRWSALAAIQETRLWFEQNEPSSPVIVLLRQSERMVGKRFSELANVIPAELLAQWDAI
DV
 
Nucleotide Sequence: 1059 bp     [Download]
>gi|172059067|ref|NC_010551.1|:3337528-3338586 Burkholderia ambifaria MC40-6 chromosome 1, complete sequence
ATGAATGCTCCCACCCCTGATGCGCTTGCGCGCTATATCGATCTTCTCGAGCCCGTATCGGCTGAAGACC
CGTGCGGCCCCGACCTCGAATACGATCCGGCCTTCGTCATGCTGCAAGCGGCCGTCGCGCCACGCCCCGA
TGCCCAATATGGCGATTTCGTCGATGCGCCGCAGCAGGCGAATTGGGCCGAGGCCGAGCGCGATTGCCGC
GCGTTGCTGCTACGCACGAAGGACCTCCGGCTGCTCACGATCCTGATCCGCTGCCGGATCCGCCAAAGCG
GCGCCGAAGGGCTGCGCGACGGCGTAGCGGTGCTGCTGCAGATGCTCGAACGCTACGGCGAGGCATTGCA
TCCGACACCGATGCTCGACGGCGAACGCGATCCGATCGTCTACTCGAACGCGATCGCCGCGCTCGCCGAC
GCCGACGCGGCGCTGGCTGACGCCCGCGACATTCGGCTGCCGAAAACCGCCGGTCTGCAACTGCAGTTGC
GCGACATCGAGAAAGCGTTTGCGGTCCCGCGCGCGAAGGACGCGCTCGCGCCGGAATCGGCGAGTCGGCT
GCTCAGCGAACTGTGGAACCGGCGCGACGCCGCGATCGTCGCACTGGCGGATGCGCAACGCGCCGTCGCC
GAGATCGTCGCGTTAACACACGACACGTTGCAGGCCGATGCGCCCGATCTCGATGGCGTCGTGAAACTGC
TACAGCCTTTCGCGCAGACGGCCCTCGACGCTGGCCGCGCACCGACCGCCGCCGGTCCGTCCGATGCACC
GGCGGAGCCGGCTTCGGCATCGGATGCGACGGCGAGCCTCCCCATCGAAGCGACGCCCCGCGAGGCCGAC
GCCCCGGCCCCGAGCGCACGCGCCCCGCGCCCGATGGATCGCTGGAGCGCGCTCGCGGCGATTCAGGAAA
CGCGTCTGTGGTTCGAGCAAAACGAGCCGAGCAGCCCCGTCATCGTGCTGCTCCGGCAATCCGAACGAAT
GGTCGGCAAGCGCTTTTCGGAGCTGGCGAACGTCATCCCAGCCGAGCTTCTCGCGCAGTGGGACGCCATC
GACGTCTGA