SecReT6
Protein ID: 172062064
SecReT6 ID269
T6SS typei3
Gene symbol-
Locus tagBamMC406_3024
StrainBurkholderia ambifaria MC40-6
Repliconchromosome I [GenBank: NC_010551] [Browse all T6SS(s) in this replicon]
Location [Strand]3354804..3356153 [-]
Producttype VI secretion protein
NoteTssK
UniProt IDB1YPT6
KEGG IDbac:BamMC406_3024
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 7.80E-140, Aligned region: 20..447
Protein Sequence: 449 a.a.     [Download]
>gi|172062064|ref|YP_001809716.1| type VI secretion protein [Burkholderia ambifaria MC40-6]
MSWHNKVVWSEGLFLLPQLFQQQERYFEHFAHKRSAPLSPFFWGFSQFEIDQESLAFGKLVFKSGAGVFP
DGTPFDVPAHAPPPPPLTIAPEHQNQVIYLAVPLRLPNTEETVFRDETASLARYLAFENELRDSNTIGQG
PKPVQLANLRLRLLPEKELTQSWIGIALTRIKTLRADGSVSLHVTDHIPPVSQYGADPLLREWATQLHGL
TKLRADALATRLSGSDGRAGAAAEVADYLLLQVLNRYEPLLEHICRIRETPPMVFYRELAMMAGELSTFV
RPQTRRPLPTPGYDHAQLFASIRPLVEEVHYLLNQVLIRGAQPIPLTEQPHGIRVAAVMPAELSGYSSLV
LAVGAQMSPDVLQQQFAAQTKISQPQRLPELIRSHLPGLTMVPLPVPPRQIPFNSSYIYYELSRSGPFWE
QIAQQGGLAMHIAGHFPELKLELWGVRHK
 
Nucleotide Sequence: 1350 bp     [Download]
>gi|172059067|ref|NC_010551.1|:c3356153-3354804 Burkholderia ambifaria MC40-6 chromosome 1, complete sequence
ATGAGTTGGCATAACAAGGTCGTGTGGAGCGAGGGTCTTTTCCTGCTGCCACAACTGTTCCAGCAGCAAG
AGCGCTATTTCGAACATTTCGCGCACAAGCGTTCCGCGCCGCTCAGCCCGTTCTTCTGGGGGTTCAGTCA
GTTCGAGATCGACCAGGAGTCGCTGGCATTCGGCAAACTCGTATTCAAGAGCGGAGCCGGCGTGTTTCCC
GACGGCACGCCTTTCGACGTGCCGGCGCATGCGCCGCCGCCGCCGCCGCTGACGATCGCGCCCGAGCACC
AGAACCAGGTGATCTATCTGGCCGTCCCGTTGCGCCTGCCCAATACCGAAGAGACGGTGTTTCGAGACGA
GACGGCATCGCTGGCTCGCTATCTGGCATTCGAAAACGAGCTGCGGGACAGCAACACGATCGGTCAAGGC
CCCAAGCCCGTGCAGCTGGCGAACCTGCGCTTGCGACTGCTGCCCGAGAAGGAACTGACGCAGTCGTGGA
TCGGCATCGCGCTGACGCGCATCAAGACGCTGCGTGCGGACGGCTCGGTGTCGCTGCACGTCACCGATCA
CATTCCGCCGGTCAGCCAGTATGGCGCCGACCCGCTGCTGCGCGAATGGGCGACGCAATTGCATGGTCTT
ACGAAGCTGCGCGCCGATGCACTGGCCACCCGCCTGTCGGGTAGCGACGGGCGTGCGGGCGCCGCGGCGG
AAGTGGCCGATTACCTGCTTCTGCAGGTGCTGAATCGCTATGAGCCGCTGCTCGAGCATATCTGCCGGAT
TCGCGAGACGCCGCCGATGGTGTTCTATCGCGAACTCGCGATGATGGCGGGCGAACTGTCGACGTTCGTT
CGTCCGCAGACGCGTCGTCCTCTGCCGACACCGGGCTACGATCATGCGCAGTTGTTTGCGAGCATCCGGC
CGCTCGTCGAAGAAGTCCACTATCTGCTCAACCAGGTGCTGATCCGCGGTGCGCAGCCGATCCCGCTCAC
CGAGCAGCCGCATGGCATCCGCGTCGCCGCGGTGATGCCGGCCGAACTGTCGGGCTATTCGAGCCTCGTG
CTGGCGGTCGGCGCGCAGATGTCGCCGGATGTGCTCCAGCAGCAATTCGCGGCGCAGACGAAGATCAGCC
AGCCGCAGCGTTTGCCGGAGCTCATTCGTTCGCACCTGCCGGGCCTGACGATGGTGCCGCTGCCGGTGCC
TCCGCGGCAGATTCCGTTCAATTCGAGCTACATCTATTACGAGCTGTCGCGCAGCGGACCGTTCTGGGAG
CAGATCGCGCAACAGGGCGGACTCGCGATGCACATCGCCGGTCATTTCCCCGAGTTGAAGCTCGAGCTCT
GGGGGGTGCGCCATAAATGA