SecReT6
Protein ID: 172062065
SecReT6 ID269
T6SS typei3
Gene symbol-
Locus tagBamMC406_3025
StrainBurkholderia ambifaria MC40-6
Repliconchromosome I [GenBank: NC_010551] [Browse all T6SS(s) in this replicon]
Location [Strand]3356155..3356697 [-]
Productputative lipoprotein
NoteTssJ
UniProt IDB1YPT7
KEGG IDbac:BamMC406_3025
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 2.60E-37, Aligned region: 26..172
Protein Sequence: 180 a.a.     [Download]
>gi|172062065|ref|YP_001809717.1| putative lipoprotein [Burkholderia ambifaria MC40-6]
MFSRFPPRMATRRNALKRIATGLTLLSLTACGGVPTRKELAASLNLKIKVSDGVNPDELGRPAPIMVRIY
ELKSAYTFDNADFFSLQNDSKKVLGEDAIVIDEFVLRPGDVRDIRRRMNSATTAIGVLAGYRELGKSVWR
GTYRMPPPPDEAWLRVLTARTKIKLNVDIGQRAVLVTELD
 
Nucleotide Sequence: 543 bp     [Download]
>gi|172059067|ref|NC_010551.1|:c3356697-3356155 Burkholderia ambifaria MC40-6 chromosome 1, complete sequence
ATGTTTTCTCGATTTCCGCCACGTATGGCGACGCGCCGCAATGCGCTCAAACGTATCGCGACCGGACTGA
CATTGTTGTCGCTTACTGCGTGCGGAGGCGTGCCGACCCGGAAGGAACTGGCCGCGTCGCTGAATCTGAA
GATCAAGGTGAGCGATGGCGTCAATCCGGACGAGCTGGGGCGGCCCGCGCCGATCATGGTGAGAATCTAT
GAATTGAAGTCGGCATATACGTTCGACAACGCCGACTTCTTCTCGCTGCAAAACGACAGCAAGAAAGTGC
TGGGCGAAGACGCGATCGTGATCGACGAGTTCGTGCTGCGTCCGGGAGACGTCCGGGATATTCGCCGGCG
CATGAACAGCGCGACGACTGCGATCGGCGTGCTGGCCGGATACCGTGAGCTCGGCAAGTCGGTGTGGCGC
GGAACGTATCGCATGCCGCCGCCGCCGGACGAAGCATGGCTTCGGGTGCTGACGGCGCGCACGAAAATCA
AACTGAACGTGGATATCGGCCAGCGGGCCGTTCTGGTTACTGAATTGGATTGA