SecReT6
Protein ID: 172062066
SecReT6 ID269
T6SS typei3
Gene symbol-
Locus tagBamMC406_3026
StrainBurkholderia ambifaria MC40-6
Repliconchromosome I [GenBank: NC_010551] [Browse all T6SS(s) in this replicon]
Location [Strand]3356832..3357314 [-]
Producthypothetical protein
NoteTssD
UniProt IDB1YPT8
KEGG IDbac:BamMC406_3026
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 4.10E-41, Aligned region: 6..136
Protein Sequence: 160 a.a.     [Download]
>gi|172062066|ref|YP_001809718.1| hypothetical protein BamMC406_3026 [Burkholderia ambifaria MC40-6]
MAHDIFLKINGIDGESKDATHHDEIEVLSWSWSVSQQSNMHLGSGGGAGRATVDDLQFEHYIDRASPNLI
QYCLLGKHIDQAKLTVRKAGGNPLEYILLTMNDVLVTHVSPAGVAADESRPREIVRLSFSRLKQEYVVQN
AQGGSGGAITATFDIKRNAA
 
Nucleotide Sequence: 483 bp     [Download]
>gi|172059067|ref|NC_010551.1|:c3357314-3356832 Burkholderia ambifaria MC40-6 chromosome 1, complete sequence
ATGGCACACGACATTTTCCTCAAGATCAACGGAATCGACGGCGAATCCAAGGATGCTACTCACCATGACG
AAATTGAGGTCTTGAGCTGGTCGTGGAGCGTATCGCAGCAATCGAACATGCACCTGGGCTCGGGCGGCGG
CGCCGGCCGGGCTACCGTGGACGATCTGCAATTCGAGCACTACATCGATCGTGCGAGCCCGAACCTGATT
CAGTACTGTCTGCTGGGCAAGCACATCGACCAAGCGAAGCTCACGGTACGCAAGGCGGGTGGGAATCCGC
TCGAATACATCCTGTTGACGATGAATGACGTGCTGGTGACGCACGTGAGCCCGGCTGGCGTTGCGGCCGA
CGAGTCGCGGCCGCGCGAAATCGTGCGCCTGTCGTTCTCGCGCCTCAAGCAGGAATACGTCGTGCAGAAC
GCGCAAGGCGGCAGCGGCGGTGCGATCACGGCGACGTTCGACATCAAGCGGAACGCGGCCTAA