SecReT6
Protein ID: 172062067
SecReT6 ID269
T6SS typei3
Gene symbol-
Locus tagBamMC406_3027
StrainBurkholderia ambifaria MC40-6
Repliconchromosome I [GenBank: NC_010551] [Browse all T6SS(s) in this replicon]
Location [Strand]3357516..3359015 [-]
ProductEvpB family type VI secretion protein
NoteTssC
UniProt IDB1YPT9
KEGG IDbac:BamMC406_3027
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.30E-195, Aligned region: 66..493
Protein Sequence: 499 a.a.     [Download]
>gi|172062067|ref|YP_001809719.1| EvpB family type VI secretion protein [Burkholderia ambifaria MC40-6]
MAVRESQARAAEAQLGAQSDFNALLSREFKPKTEQAREAVESAVKTLAEQALANSVTMSDDAYKSIEAII
GEIDRKLSEQINLILHHDDFQKLESAWRGLHHLVTNTETDEKLKIRFMDVSKEDLRRTMKRYKGVAWDQS
PFFKQIYEEEYGQLGGEPYGCLVADYYFDHTPPDVDLLASIGKVAAAAHAPFITGASPSVLQMDSWQELA
NPRDLTKIFTQNLEYAPWNSLRNSEDSRYIGLAMPRFLARLPYGIRTNPVDEFDFEESTDGSDHRKYSWA
NAAYAMAVNINRSFKHYGWCTLIRGVESGGVVENLPCHTFPTDDGGIDMKCPTEIAISDRREAELSKNGF
IPLIHRKNTDYAAFIGAQSLQKPAEYYDPDATANANLSARLPYLFACSRFAHYLKCIVRDKIGSFKERDE
MQQWLNEWIMYYVDADPANSSQETKARRPLAAAEVVVEEVEGNPGYYQAKFFLRPHFQLEGLTVSLRLVA
KLPSVKAAA
 
Nucleotide Sequence: 1500 bp     [Download]
>gi|172059067|ref|NC_010551.1|:c3359015-3357516 Burkholderia ambifaria MC40-6 chromosome 1, complete sequence
ATGGCTGTACGTGAATCGCAGGCGCGCGCTGCCGAGGCGCAGCTCGGAGCCCAATCGGATTTCAACGCGC
TGTTGTCGCGTGAGTTCAAGCCCAAGACCGAACAGGCGCGCGAGGCGGTGGAGTCTGCCGTCAAGACGCT
CGCCGAGCAGGCATTGGCCAATTCGGTGACGATGTCGGACGACGCCTACAAGAGTATCGAGGCGATCATC
GGCGAGATCGACCGCAAGTTGTCGGAGCAGATCAACCTGATTCTGCACCACGACGATTTCCAGAAGCTGG
AAAGCGCGTGGCGTGGATTGCATCATCTCGTGACCAACACGGAAACCGACGAGAAGCTGAAAATCCGCTT
CATGGACGTGTCCAAGGAAGACCTGCGTCGCACGATGAAGCGCTACAAGGGCGTGGCTTGGGATCAGAGC
CCGTTCTTCAAGCAGATCTACGAAGAGGAGTACGGACAGTTGGGCGGGGAGCCGTACGGCTGCCTGGTGG
CCGACTATTATTTCGACCACACGCCGCCGGACGTCGATCTGCTCGCATCGATCGGCAAGGTCGCCGCGGC
CGCGCACGCACCGTTCATTACGGGCGCGTCGCCGTCCGTGCTGCAGATGGATTCGTGGCAGGAGCTCGCG
AACCCGCGCGATCTGACCAAGATTTTCACGCAGAACCTCGAGTACGCACCGTGGAACTCGCTGCGTAACT
CCGAAGACTCTCGCTACATTGGTCTTGCCATGCCGCGCTTCCTCGCGCGGCTGCCGTACGGCATTCGCAC
CAATCCGGTCGACGAATTCGATTTCGAAGAGTCGACCGACGGCTCGGATCACCGCAAGTACTCGTGGGCG
AACGCGGCTTATGCGATGGCGGTCAACATCAATCGATCGTTCAAGCACTACGGCTGGTGCACGCTGATTC
GCGGCGTCGAGAGCGGCGGCGTGGTCGAAAATCTGCCGTGCCATACGTTCCCGACCGACGACGGCGGCAT
CGACATGAAGTGCCCGACCGAGATCGCGATTTCGGACCGGCGCGAGGCGGAGCTTTCGAAGAACGGTTTC
ATTCCGCTGATCCACCGCAAGAATACCGATTACGCGGCGTTCATCGGCGCCCAGTCGCTGCAGAAGCCTG
CCGAGTACTACGATCCGGACGCGACGGCCAACGCGAATCTTTCCGCGCGTCTGCCGTATCTGTTTGCGTG
CTCGCGTTTCGCGCACTACCTGAAGTGCATCGTGCGCGACAAGATCGGCTCGTTCAAGGAGCGCGACGAA
ATGCAGCAATGGCTCAACGAATGGATCATGTACTACGTTGACGCCGATCCCGCGAACTCGTCTCAGGAAA
CCAAGGCGCGTCGCCCGCTGGCCGCTGCCGAGGTGGTCGTGGAAGAAGTCGAGGGCAACCCCGGCTACTA
CCAGGCGAAATTCTTCCTGCGCCCGCACTTCCAGCTGGAAGGTCTGACCGTGTCGCTGCGGCTCGTCGCG
AAGCTTCCGTCGGTCAAGGCCGCTGCCTGA