SecReT6
Protein ID: 172062068
SecReT6 ID269
T6SS typei3
Gene symbol-
Locus tagBamMC406_3028
StrainBurkholderia ambifaria MC40-6
Repliconchromosome I [GenBank: NC_010551] [Browse all T6SS(s) in this replicon]
Location [Strand]3359063..3359599 [-]
Producttype VI secretion protein
NoteTssB
UniProt IDB1YPU0
KEGG IDbac:BamMC406_3028
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.30E-60, Aligned region: 11..164
Protein Sequence: 178 a.a.     [Download]
>gi|172062068|ref|YP_001809720.1| type VI secretion protein [Burkholderia ambifaria MC40-6]
MAISSSAQKFIARNRAPRVQIEYDVEIYGSEKKVELPFVMGVLADLSGKPLESLPAVSDRKFYNIDIDNF
DERMKAMKPRVAFSVPNTLSGDGQLLVDITFESMDDFSPAAIARNVDALSQLLDARTQLANLQTYMDGKS
GAENLVSKVLKDPALLSALAKAPKPEARKQDAQEPQEQ
 
Nucleotide Sequence: 537 bp     [Download]
>gi|172059067|ref|NC_010551.1|:c3359599-3359063 Burkholderia ambifaria MC40-6 chromosome 1, complete sequence
ATGGCCATATCCAGCAGTGCACAGAAATTCATTGCGCGAAATCGTGCTCCGCGCGTCCAGATCGAGTACG
ACGTCGAGATCTACGGCTCCGAGAAAAAGGTGGAGCTGCCGTTCGTGATGGGCGTGCTCGCCGATCTGTC
CGGCAAGCCGCTGGAGTCGTTGCCGGCAGTCAGCGATCGCAAGTTCTACAACATCGACATCGACAACTTC
GACGAGCGGATGAAGGCGATGAAGCCGCGCGTCGCGTTTTCGGTCCCGAATACGCTGTCGGGCGACGGCC
AGCTGCTGGTCGACATCACGTTCGAAAGCATGGACGACTTCTCGCCGGCCGCGATTGCGCGAAATGTCGA
TGCGCTGTCGCAGCTGCTCGACGCGCGCACGCAGCTCGCCAACCTGCAGACCTACATGGACGGCAAATCG
GGCGCGGAGAATCTCGTCAGCAAGGTGCTGAAGGACCCGGCGCTGCTGAGCGCGCTCGCCAAGGCACCGA
AGCCTGAAGCACGGAAGCAGGACGCTCAGGAGCCGCAAGAACAGTAA