SecReT6
Protein ID: 172062070
SecReT6 ID269
T6SS typei3
Gene symbol-
Locus tagBamMC406_3030
StrainBurkholderia ambifaria MC40-6
Repliconchromosome I [GenBank: NC_010551] [Browse all T6SS(s) in this replicon]
Location [Strand]3361619..3362323 [-]
Producthypothetical protein
NoteTssL
UniProt IDB1YPU2
KEGG IDbac:BamMC406_3030
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 3.00E-19, Aligned region: 10..135
Protein Sequence: 234 a.a.     [Download]
>gi|172062070|ref|YP_001809722.1| hypothetical protein BamMC406_3030 [Burkholderia ambifaria MC40-6]
MTLDSSGAALRASLQETVLHIALLAQGASMPEVHAWRARCIGLVERLEQAMRDDGRASDVVRDVGIAQCM
LLDEVTLRHLPAVRRDEWLRETLLFRFHRAHSGAARPCAQIDALLNGAGSEAALLNMYTALLGLGSSQER
DALRACLSTPCPGTSPAETRGADAANPPAQPSSWFASSVAAVAARAWGPLRPVLLAMVVLTAVWIFCDVS
LWRAVERLPDSGPRVAQNGDGGRQ
 
Nucleotide Sequence: 705 bp     [Download]
>gi|172059067|ref|NC_010551.1|:c3362323-3361619 Burkholderia ambifaria MC40-6 chromosome 1, complete sequence
ATGACATTGGACAGTTCAGGCGCCGCGTTGCGCGCGTCGCTTCAAGAGACCGTACTGCATATCGCGCTGC
TCGCGCAGGGTGCGTCGATGCCGGAAGTCCACGCCTGGCGCGCGCGCTGTATCGGGCTCGTCGAGCGGCT
CGAGCAGGCGATGCGCGACGACGGCCGGGCAAGCGATGTCGTGCGCGACGTCGGCATCGCGCAATGCATG
TTGCTGGACGAGGTGACGTTGCGCCACCTGCCGGCGGTCAGGCGCGACGAGTGGTTGCGCGAGACGCTGC
TGTTCCGCTTTCATCGCGCACACAGCGGCGCGGCGCGACCCTGCGCGCAAATCGACGCGTTGCTGAACGG
TGCGGGTTCGGAAGCGGCGTTGCTGAATATGTATACGGCGCTGCTAGGGCTTGGGTCGTCGCAGGAACGC
GACGCGCTTCGGGCGTGTCTGAGCACCCCGTGTCCCGGGACATCGCCGGCAGAAACGCGCGGGGCCGACG
CGGCGAATCCGCCGGCGCAGCCATCATCGTGGTTTGCGAGTTCGGTTGCCGCTGTCGCGGCGCGTGCATG
GGGGCCGCTTCGGCCGGTGTTGTTGGCAATGGTAGTGCTGACGGCAGTGTGGATCTTCTGCGACGTCTCG
TTGTGGCGTGCGGTGGAGCGCTTGCCCGACTCGGGCCCGCGCGTTGCGCAGAACGGCGACGGAGGGCGCC
AATGA