SecReT6
Protein ID: 184157616
SecReT6 ID273
T6SS typei4b
Gene symbol-
Locus tagACICU_01296
StrainAcinetobacter baumannii ACICU
Repliconchromosome [GenBank: NC_010611] [Browse all T6SS(s) in this replicon]
Location [Strand]1397691..1398194 [+]
Producthypothetical protein
NoteTssB
UniProt IDB2HXK9
KEGG IDabc:ACICU_01296
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.80E-58, Aligned region: 11..166
Protein Sequence: 167 a.a.     [Download]
>gi|184157616|ref|YP_001845955.1| hypothetical protein ACICU_01296 [Acinetobacter baumannii ACICU]
MAKRESVQKKLQRIRPPRVQLTYDVEIGDAKEAKELPFVVGVMGDFSAASELERTKLKDKKFINVDLDNI
DEVMESLSPRAAFQVDNTLTEEGGKMAVDLTFKSMEDFRPENVVQQVDPLKKLVEARERLTDLRNKISNS
ERLEDLLDEVLKNTDQIRKLSAEADHE
 
Nucleotide Sequence: 504 bp     [Download]
>gi|184156320|ref|NC_010611.1|:1397691-1398194 Acinetobacter baumannii ACICU chromosome, complete genome
ATGGCTAAGAGAGAAAGCGTACAAAAGAAGCTTCAGCGAATTCGACCTCCTCGTGTTCAGCTTACATATG
ATGTCGAAATTGGTGATGCGAAAGAAGCGAAAGAACTACCATTCGTTGTAGGTGTAATGGGTGATTTTTC
AGCTGCATCTGAGCTTGAGCGTACAAAATTAAAAGATAAAAAATTCATTAATGTCGATTTAGATAATATT
GATGAAGTAATGGAATCTCTGTCTCCAAGAGCTGCTTTTCAAGTAGACAATACGTTGACAGAAGAAGGCG
GTAAAATGGCAGTTGATTTAACGTTTAAGTCAATGGAAGATTTTCGCCCGGAAAATGTTGTACAGCAAGT
TGATCCATTAAAGAAATTGGTTGAGGCGCGTGAGCGTTTAACCGATTTAAGAAACAAAATTTCAAACAGT
GAGCGTTTAGAAGATCTGCTTGATGAGGTTCTTAAAAATACTGATCAAATCCGTAAATTAAGTGCCGAGG
CCGATCATGAATAA