SecReT6
Protein ID: 184157618
SecReT6 ID273
T6SS typei4b
Gene symbol-
Locus tagACICU_01298
StrainAcinetobacter baumannii ACICU
Repliconchromosome [GenBank: NC_010611] [Browse all T6SS(s) in this replicon]
Location [Strand]1399718..1400221 [+]
Producthemolysin-coregulated protein
NoteTssD
UniProt IDB2HXL1
KEGG IDabc:ACICU_01298
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 4.30E-43, Aligned region: 5..140
Protein Sequence: 167 a.a.     [Download]
>gi|184157618|ref|YP_001845957.1| hemolysin-coregulated protein [Acinetobacter baumannii ACICU]
MKDIYVEFRGKYKVDGESRDSEHKGWLEVNSWSHNIRQPKSATSSSVGGHTAERVEHSDMVFVKDLDATS
PKLWEACSAGYTFDEVQIDFYRANGDKRIKYLQIKLKHVLVSSVTPTVNEEGVPTEAFGLKYAAVEWTYN
QQDINGTAKGAVTKKWSLSNNTASYAA
 
Nucleotide Sequence: 504 bp     [Download]
>gi|184156320|ref|NC_010611.1|:1399718-1400221 Acinetobacter baumannii ACICU chromosome, complete genome
ATGAAAGATATATACGTTGAGTTTCGCGGTAAATATAAAGTTGATGGAGAATCTCGTGATTCTGAGCACA
AAGGTTGGTTAGAAGTTAACTCTTGGTCTCATAACATCCGTCAACCTAAATCTGCTACTTCAAGTAGTGT
AGGCGGCCACACTGCTGAACGTGTTGAACATTCTGACATGGTTTTCGTGAAAGACTTAGACGCAACTAGC
CCTAAATTATGGGAAGCTTGTTCAGCTGGTTATACATTTGATGAAGTACAAATCGACTTCTATCGCGCAA
ATGGCGATAAACGTATCAAGTACTTACAAATCAAATTGAAGCACGTTTTAGTTTCTAGTGTGACTCCAAC
TGTTAACGAAGAAGGCGTTCCTACAGAAGCATTCGGTTTGAAATATGCTGCTGTTGAGTGGACTTATAAC
CAACAAGATATTAACGGTACTGCTAAAGGTGCTGTTACTAAGAAATGGTCACTTTCTAATAATACAGCTT
CTTACGCAGCGTAA