SecReT6
Protein ID: 184157619
SecReT6 ID273
T6SS typei4b
Gene symbol-
Locus tagACICU_01299
StrainAcinetobacter baumannii ACICU
Repliconchromosome [GenBank: NC_010611] [Browse all T6SS(s) in this replicon]
Location [Strand]1400301..1400777 [+]
Producthypothetical protein
NoteTssE
UniProt IDB2HXL2
KEGG IDabc:ACICU_01299
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.30E-18, Aligned region: 32..135
Protein Sequence: 158 a.a.     [Download]
>gi|184157619|ref|YP_001845958.1| hypothetical protein ACICU_01299 [Acinetobacter baumannii ACICU]
MNLDRLYPYGFRSTLFDRLIPESEDYAKGLSIQQLRESVAKDLEDLLNSRVAKLDHVIDDYPLVKKSILQ
FGIIDFVGLSTANPLDRDKICQSIEQSIAAHEPRLRQIRVEMLLDGHNMGALCLSIQAYLNIHPLYEPVV
FDALLKPTTQQYVISART
 
Nucleotide Sequence: 477 bp     [Download]
>gi|184156320|ref|NC_010611.1|:1400301-1400777 Acinetobacter baumannii ACICU chromosome, complete genome
ATGAACTTAGATCGGCTTTATCCATACGGATTTCGTTCAACTTTATTTGATCGTTTAATTCCAGAAAGTG
AAGATTATGCAAAAGGTCTTTCTATTCAGCAATTAAGAGAATCTGTAGCAAAGGATTTAGAAGATTTGCT
CAATAGTCGGGTAGCAAAGTTAGATCATGTGATTGATGACTATCCACTTGTAAAAAAATCGATACTTCAG
TTCGGGATTATTGATTTTGTGGGGCTTTCTACAGCCAACCCTCTGGATCGGGATAAAATTTGCCAATCCA
TTGAGCAATCAATAGCAGCTCATGAACCTCGGCTAAGACAAATACGGGTAGAGATGTTATTAGATGGACA
TAATATGGGCGCATTATGTTTAAGTATTCAGGCTTATCTAAATATTCACCCCTTATATGAACCTGTTGTA
TTTGATGCATTGTTAAAACCAACAACGCAGCAATATGTAATTTCAGCAAGAACTTAA