SecReT6
Protein ID: 184157620
SecReT6 ID273
T6SS typei4b
Gene symbol-
Locus tagACICU_01300
StrainAcinetobacter baumannii ACICU
Repliconchromosome [GenBank: NC_010611] [Browse all T6SS(s) in this replicon]
Location [Strand]1400794..1402605 [+]
Producthypothetical protein
NoteTssF
UniProt IDB2HXL3
KEGG IDabc:ACICU_01300
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 9.90E-156, Aligned region: 5..603
Protein Sequence: 603 a.a.     [Download]
>gi|184157620|ref|YP_001845959.1| hypothetical protein ACICU_01300 [Acinetobacter baumannii ACICU]
MIEELLPFYEKQLQEFGQQSREFAQKYPKIAQRLSLNQEQIDDPHIERLIQAFSLIAARIDKKLTDSYDV
FTRSLFEVMFPQYLRHFPACSVVSFEDINKIKQLTEPHLVPHHTVLKSRSFKGVQCEFNTTQEVKLLPIH
LSGLDFKTTPSAHMHLNQNATLSLKFEIFNNAHACLTDEKLPIYLDAISNFPLQVLDSIFKKGTSFAVKY
GQTIVELSKNPFELIGFAEQESLLPLDQHTHHAYRLLMEYFCFPEKFSYLKLDLDFLRRLPQHVSEFELL
IHFKLNLNDQAVVRNYSELNIANFKLFTTPVINLFEKYAEPQKIVHKQLEYPLVTDAHHPEFYQVYSILE
MNMVREKTNQEESYVPVLPFFAMSHYHNDTARFFYSVNYQKLQSNFVEMGYSIISKNLNPFSTRSDFIST
KLLCSNRDLPHEALGQSNNVLNLNDSSLARRAIVLKRPTKPYKFEQGQSEQWRVISHLSLNSLALMKGDA
VSHVKELLALYNLPQSKENYLIIESIKKLEFSLTHKLVDGKPFPMFVRGVKAELQIDSSVFRGHSLYIFS
QLLSRVFNLKVQINSFVDLVVKDYSSQQELYQCSQNVGGKTLL
 
Nucleotide Sequence: 1812 bp     [Download]
>gi|184156320|ref|NC_010611.1|:1400794-1402605 Acinetobacter baumannii ACICU chromosome, complete genome
GTGATAGAAGAGCTTTTACCGTTTTATGAAAAACAATTACAAGAATTTGGTCAACAATCTCGAGAATTTG
CCCAAAAATATCCAAAAATTGCTCAGCGCTTATCTTTAAATCAAGAGCAAATTGATGACCCACATATTGA
ACGTCTGATTCAGGCTTTTTCGCTGATTGCTGCTCGAATCGATAAAAAACTAACAGACAGTTACGATGTT
TTTACTCGTTCTTTATTTGAGGTGATGTTCCCTCAATACTTACGGCATTTTCCTGCGTGTTCAGTTGTTA
GCTTTGAAGATATTAATAAGATTAAACAGCTTACAGAACCTCATCTTGTACCTCATCATACGGTTTTGAA
ATCTCGTAGTTTCAAAGGAGTACAGTGTGAGTTTAATACAACTCAAGAGGTTAAATTACTACCTATTCAT
TTAAGTGGTTTAGATTTTAAAACTACACCTAGTGCACATATGCACTTAAATCAAAATGCGACGTTGAGCC
TTAAATTTGAAATTTTTAATAATGCTCATGCTTGTTTAACTGATGAGAAGCTTCCTATTTATTTGGATGC
TATCTCTAATTTTCCTCTACAGGTCCTTGATAGTATTTTCAAAAAAGGAACCAGTTTTGCGGTTAAATAT
GGACAAACAATTGTAGAATTGAGCAAGAATCCATTTGAATTGATTGGTTTTGCAGAACAAGAAAGTTTAT
TACCGCTTGATCAACATACCCATCATGCTTATCGTTTGTTGATGGAATACTTTTGTTTCCCGGAAAAGTT
TAGTTATCTTAAGCTCGATTTGGATTTTTTAAGGCGACTACCTCAGCATGTATCCGAATTTGAGCTTTTA
ATTCATTTCAAATTAAACTTAAATGATCAAGCCGTTGTTAGAAACTATTCTGAGCTAAATATTGCAAACT
TTAAATTATTTACTACCCCCGTAATTAATTTATTTGAAAAATATGCTGAACCCCAGAAGATAGTTCACAA
GCAATTAGAATATCCTTTAGTTACAGACGCTCACCATCCTGAATTTTATCAAGTATATTCAATACTTGAG
ATGAATATGGTGCGTGAAAAAACAAATCAGGAAGAAAGCTATGTTCCTGTTTTGCCTTTTTTTGCGATGA
GCCATTACCACAATGATACAGCTCGCTTTTTTTACTCAGTAAACTATCAAAAGTTACAGTCCAATTTCGT
TGAAATGGGCTATTCGATTATTTCTAAAAATTTAAATCCATTTTCAACGCGCTCAGATTTTATTAGCACT
AAATTATTATGTTCAAACCGTGATTTACCTCATGAAGCACTGGGTCAGTCTAATAACGTATTAAATTTAA
ATGATAGTAGCTTGGCGAGACGTGCCATTGTTTTAAAACGACCTACAAAGCCTTATAAGTTTGAACAAGG
CCAAAGTGAACAGTGGCGTGTGATCTCGCATCTTTCATTAAATAGCTTAGCACTTATGAAAGGGGATGCT
GTTTCTCATGTTAAAGAGCTGCTGGCTTTATATAACTTACCGCAGTCAAAAGAAAACTATTTAATTATAG
AATCAATTAAAAAATTAGAATTTTCTCTTACCCATAAACTCGTAGATGGCAAACCATTTCCAATGTTTGT
AAGAGGAGTAAAAGCTGAATTACAAATTGATTCATCCGTATTTAGAGGGCATAGCTTATATATTTTTAGT
CAGTTATTAAGTCGTGTTTTTAATTTAAAGGTTCAAATTAATAGTTTTGTTGATTTGGTGGTTAAGGATT
ATTCATCTCAGCAGGAGTTATACCAATGCAGTCAGAACGTTGGTGGCAAGACTCTTCTGTAA