SecReT6
Protein ID: 184157621
SecReT6 ID273
T6SS typei4b
Gene symbol-
Locus tagACICU_01301
StrainAcinetobacter baumannii ACICU
Repliconchromosome [GenBank: NC_010611] [Browse all T6SS(s) in this replicon]
Location [Strand]1402569..1403567 [+]
Producthypothetical protein
NoteTssG
UniProt IDB2HXL4
KEGG IDabc:ACICU_01301
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.70E-63, Aligned region: 18..312
Protein Sequence: 332 a.a.     [Download]
>gi|184157621|ref|YP_001845960.1| hypothetical protein ACICU_01301 [Acinetobacter baumannii ACICU]
MQSERWWQDSSVTAELFQRPKSFEFIQATRLLRHMPANDAALSWSDHFKFETSFNLNFPATEIESLELVD
ERVHLTNLIVGLTGIQGALPYTYTNKIKQAPRQQRAETKEFLSLFNHKLTSQYVESSITYHLPVRYEIEN
KNDYLDILHALNGYVRSQHQQQDLDEYFAEFSGLMQGQNNTVHALKTMLSCIFKHEITIKEFVQESFKLA
GDQLTTLGGSQPSLLGINTFCGETIQQIDGKIEIQIGPLKRQQYLKFLPHQELSLKLKKIVETWCSPTLS
IDLRLILDETEIQPVRLTQGQESGLGQGAFLMSRKPNTHNDETCYSLIGEQI
 
Nucleotide Sequence: 999 bp     [Download]
>gi|184156320|ref|NC_010611.1|:1402569-1403567 Acinetobacter baumannii ACICU chromosome, complete genome
ATGCAGTCAGAACGTTGGTGGCAAGACTCTTCTGTAACGGCTGAGTTGTTTCAACGCCCTAAGTCTTTTG
AGTTTATTCAAGCAACACGTTTATTGCGTCATATGCCTGCCAATGACGCAGCTTTATCATGGTCTGACCA
TTTTAAATTTGAGACCTCATTTAACTTAAACTTTCCAGCCACTGAAATTGAAAGTTTAGAGTTAGTAGAT
GAACGTGTTCATTTAACAAACCTGATCGTTGGTCTGACTGGTATACAAGGTGCATTACCTTATACATATA
CAAATAAAATTAAGCAGGCTCCAAGGCAACAACGCGCTGAAACGAAAGAGTTTTTAAGCTTATTTAATCA
TAAGCTGACCAGTCAGTATGTAGAGTCAAGTATTACTTATCACTTGCCTGTGCGCTATGAAATTGAAAAT
AAAAATGATTATTTGGATATTCTCCATGCATTGAATGGTTATGTTCGCTCACAACATCAGCAACAAGACT
TGGATGAATATTTCGCTGAATTTTCAGGCCTAATGCAGGGGCAAAATAATACGGTTCATGCTTTAAAGAC
GATGTTGAGTTGTATTTTTAAGCATGAAATTACAATTAAAGAGTTTGTACAGGAATCGTTTAAGTTAGCG
GGTGATCAGCTAACCACTTTAGGCGGAAGTCAACCGAGCTTACTTGGTATTAACACATTTTGTGGGGAAA
CGATTCAACAAATTGATGGAAAAATTGAGATTCAAATAGGTCCGCTTAAGCGTCAGCAATATTTAAAATT
TTTACCTCATCAAGAGCTTAGCTTAAAGCTCAAAAAAATCGTAGAAACCTGGTGCAGTCCAACTTTATCG
ATAGATTTAAGATTGATATTGGATGAGACTGAAATACAACCTGTTCGCTTAACTCAAGGCCAAGAAAGTG
GTTTAGGGCAAGGCGCTTTTTTAATGTCTCGTAAGCCTAATACACATAACGATGAAACATGTTATAGCCT
TATTGGAGAGCAAATATGA