SecReT6
Protein ID: 184157626
SecReT6 ID273
T6SS typei4b
Gene symbol-
Locus tagACICU_01306
StrainAcinetobacter baumannii ACICU
Repliconchromosome [GenBank: NC_010611] [Browse all T6SS(s) in this replicon]
Location [Strand]1410615..1410878 [+]
Producthypothetical protein
NotePAAR
UniProt IDB2HXL9
KEGG IDabc:ACICU_01306
PDB IDNA
Domain hit(s) vs Pfam PAAR_motif [PF05488], Evalue: 1.10E-21, Aligned region: 7..79
Protein Sequence: 87 a.a.     [Download]
>gi|184157626|ref|YP_001845965.1| hypothetical protein ACICU_01306 [Acinetobacter baumannii ACICU]
MASPYITIGCPTTGGGQVISGNSAFLIEGIAIACVGDKATCPAHKTVSTIVSGDPNMQVMGKAAARVNDS
LSCGCKLLPKQSLVNQG
 
Nucleotide Sequence: 264 bp     [Download]
>gi|184156320|ref|NC_010611.1|:1410615-1410878 Acinetobacter baumannii ACICU chromosome, complete genome
ATGGCTAGCCCTTACATTACGATTGGATGCCCAACGACAGGTGGAGGGCAAGTCATTTCTGGTAATAGTG
CATTTTTAATTGAGGGAATCGCAATTGCATGTGTAGGTGATAAAGCAACTTGTCCGGCGCATAAAACGGT
TTCTACGATTGTTTCCGGTGACCCAAATATGCAAGTGATGGGAAAAGCAGCAGCAAGAGTAAATGATTCA
TTATCGTGTGGCTGTAAATTATTACCGAAACAAAGTTTGGTTAATCAAGGGTAG