SecReT6
Protein ID: 184157629
SecReT6 ID273
T6SS typei4b
Gene symbol-
Locus tagACICU_01309
StrainAcinetobacter baumannii ACICU
Repliconchromosome [GenBank: NC_010611] [Browse all T6SS(s) in this replicon]
Location [Strand]1414913..1416277 [+]
Producthypothetical protein
NoteTssK
UniProt IDB2HXM2
KEGG IDabc:ACICU_01309
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.90E-125, Aligned region: 19..451
Protein Sequence: 454 a.a.     [Download]
>gi|184157629|ref|YP_001845968.1| hypothetical protein ACICU_01309 [Acinetobacter baumannii ACICU]
MFKAEKVLWGEGLFLRPQHFQIQDTYHEQRLNHTVRAVVPFSYGVQKLSFDEAQLSTHILALESVEMIWQ
DGEIYQAPAYDLLPEPILLDELNLRGEMVIYLALPLLQANKQNLIDQNQSQKGRYQSHLVETHDLFTNAT
EADISLLRRRAVFKLLDAHSNPDHNLDGFLYLPIGKIKRQSSGAFEIDRKFIPPILHVDASETLVSNLKR
TLNVIKAKIKTIQTNNRENEQKLIEFRSGDIVSFWLVNALNTAHAGLSHFLQYPQIHPERLFFELLRLAG
SLLTFSTAYEVDQLPAYKHHNLQESFTQLDTILRDLLDTIISSRYISIALKEIRPSYWVGSLETDKITRD
TRLYIAVSSSVMQTHELIQIVPLRFKIGSTLDVEQRVVAALPAIPLHHLIQVPTAIPVRSGVSYFEIELH
HELYQRMLDSETICIYVPAGFQDISIELIAVMNA
 
Nucleotide Sequence: 1365 bp     [Download]
>gi|184156320|ref|NC_010611.1|:1414913-1416277 Acinetobacter baumannii ACICU chromosome, complete genome
ATGTTTAAAGCTGAAAAAGTCCTGTGGGGTGAAGGTTTATTTTTAAGACCTCAACATTTCCAGATTCAAG
ATACCTATCATGAACAACGTTTAAATCATACGGTTCGTGCTGTTGTTCCATTTTCCTATGGCGTTCAAAA
ACTTAGTTTTGATGAAGCACAGTTAAGTACGCATATTCTTGCACTTGAATCGGTAGAAATGATTTGGCAA
GATGGTGAAATATATCAAGCGCCTGCTTATGACTTATTACCTGAACCTATTTTGCTTGATGAGCTTAATT
TACGTGGTGAAATGGTCATCTATTTGGCATTACCATTATTACAAGCCAATAAACAAAATTTAATCGATCA
AAATCAATCACAAAAGGGGCGCTATCAATCACATTTGGTTGAGACCCATGATCTGTTCACAAACGCGACA
GAGGCTGATATCAGCTTATTACGTCGTCGAGCTGTGTTTAAATTATTAGATGCACATAGTAATCCTGATC
ATAATTTAGATGGTTTCCTGTATTTGCCAATAGGCAAAATTAAACGTCAGAGTTCAGGTGCTTTTGAAAT
TGACCGCAAATTTATTCCGCCCATTTTGCATGTCGATGCATCTGAGACCTTGGTTTCAAATTTAAAAAGA
ACCTTGAATGTTATTAAGGCAAAAATTAAAACGATTCAAACCAATAACCGAGAAAATGAGCAGAAATTAA
TTGAATTCCGTTCAGGTGATATCGTTTCGTTTTGGTTGGTAAATGCTTTAAATACTGCTCATGCTGGTCT
GAGCCATTTCTTGCAATATCCGCAAATTCATCCGGAACGATTATTCTTTGAATTGCTACGTTTAGCAGGT
TCATTATTAACCTTCTCGACAGCTTATGAAGTTGATCAGTTACCTGCATATAAACATCATAATTTGCAAG
AGAGTTTCACCCAGCTCGACACAATTTTACGTGATTTACTCGATACGATTATTTCGAGTCGTTACATCAG
TATTGCCCTTAAAGAAATTCGCCCTTCATATTGGGTGGGAAGTCTCGAAACCGATAAGATTACTCGAGAT
ACCAGACTTTATATTGCTGTATCAAGTAGCGTGATGCAGACCCATGAGTTGATTCAAATCGTTCCTCTAC
GTTTTAAAATCGGTAGTACTTTAGATGTTGAACAACGTGTTGTTGCAGCATTACCAGCAATTCCATTACA
CCACTTAATCCAAGTTCCAACTGCTATTCCAGTACGTTCGGGTGTGAGCTATTTTGAAATCGAACTGCAT
CATGAACTCTATCAACGTATGTTGGATTCAGAAACGATTTGTATTTATGTTCCGGCTGGATTCCAAGATA
TCAGTATTGAGCTGATTGCGGTCATGAACGCTTAA