SecReT6
Protein ID: 186470892
SecReT6 ID275
T6SS typei3
Gene symbol-
Locus tagBphy_6107
StrainBurkholderia phymatum STM815
Repliconplasmid pBPHY01 [GenBank: NC_010625] [Browse all T6SS(s) in this replicon]
Location [Strand]654398..655630 [-]
ProductDotU family type IV/VI secretion system protein
NoteTssL
UniProt IDB2JW37
KEGG IDbph:Bphy_6107
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 4.00E-40, Aligned region: 32..251
OmpA [PF00691], Evalue: 9.80E-14, Aligned region: 305..402
VirB8 [PF04335], Evalue: 0.0066, Aligned region: 216..272
Protein Sequence: 410 a.a.     [Download]
>gi|186470892|ref|YP_001862210.1| unnamed protein product [Burkholderia phymatum STM815]
MSATAASPQPRYEAEPAAPYRERVRAAEGAANPLLEAARPLLDALANTPAELDAAGVAQHRLSLVQHLRM
FGKVCGELRLPAEHIEKAQYCLCSALDEAAGLTDWGNGSRLGMDWRATGLATTSGYDRQGGDRVYAIATD
AMHNQRENRCLIEVIQHILDRGFRGRYRFANDSDHQIAVVRKQVDQAVVTSGHSPPVSGEHMLTTGGAPP
VYHLRVEAQPLSQAPRKSRRWMAIGALCLVLLAGAAVAGYWRYTKVRQAEPPVSPIDALAGRLAGHLADE
VNAGTVTLAENAQHTTLSLRLEGIFEAGQSSVNPWVKPLITTIGQEVAKTPGRVLVTGHTDSQPFSHMQR
SSNLALSDARAQEVAQILVSAGVATDRIDSTGKGNAEPAADNATPQGRLRNRRVEITVFE
 
Nucleotide Sequence: 1233 bp     [Download]
>gi|186470346|ref|NC_010625.1|:c655630-654398 Burkholderia phymatum STM815 plasmid pBPHY01, complete sequence
ATGAGTGCGACAGCAGCTTCACCACAACCGCGATACGAAGCCGAACCTGCTGCGCCGTATCGCGAACGCG
TTCGCGCGGCCGAAGGCGCAGCCAATCCCCTGCTCGAAGCTGCTCGCCCACTGCTGGATGCACTCGCGAA
TACGCCCGCCGAACTCGATGCAGCCGGCGTTGCCCAGCATCGGCTGTCACTGGTACAGCACCTCCGGATG
TTCGGGAAAGTCTGCGGCGAACTCAGGCTGCCTGCGGAACACATCGAAAAGGCACAATACTGCCTGTGCT
CCGCATTGGACGAAGCGGCCGGGCTGACCGACTGGGGCAATGGCTCAAGGCTTGGCATGGACTGGCGTGC
AACGGGACTCGCCACCACATCGGGCTATGACCGGCAAGGTGGCGACCGCGTCTACGCCATCGCCACGGAT
GCCATGCACAATCAGCGTGAAAATCGCTGCCTCATTGAAGTCATCCAGCACATCCTCGACCGGGGATTCA
GGGGCCGCTACCGGTTCGCCAACGACAGCGACCACCAGATAGCGGTAGTGCGCAAACAGGTCGATCAGGC
CGTCGTCACCTCCGGACACTCTCCTCCAGTGTCCGGTGAACACATGCTGACAACGGGGGGCGCGCCCCCG
GTCTATCACCTGCGGGTCGAGGCGCAGCCGCTATCGCAGGCTCCGCGGAAATCGCGGCGCTGGATGGCTA
TCGGTGCGTTATGCCTCGTTCTTCTCGCTGGCGCCGCCGTAGCAGGGTACTGGCGTTACACGAAGGTCAG
GCAGGCCGAGCCCCCTGTGTCGCCAATCGATGCACTGGCAGGCAGGCTCGCCGGCCACCTCGCGGACGAA
GTGAATGCGGGCACCGTCACCCTGGCAGAAAATGCCCAGCACACCACGCTCTCCCTCCGGCTCGAGGGCA
TCTTCGAGGCCGGACAGTCGAGTGTCAATCCGTGGGTCAAGCCCTTGATCACCACCATCGGGCAGGAAGT
CGCGAAAACTCCCGGAAGGGTCCTCGTCACGGGCCATACCGACAGCCAGCCTTTCTCCCATATGCAACGC
AGCTCCAACCTGGCACTGTCCGATGCGCGCGCACAGGAGGTTGCACAGATTCTGGTCTCCGCCGGCGTGG
CTACCGATCGCATCGACTCGACCGGAAAGGGTAACGCAGAGCCGGCTGCCGACAACGCGACACCTCAGGG
CAGACTGAGAAATCGCCGTGTCGAGATCACCGTATTCGAGTAG