SecReT6
Protein ID: 186470894
SecReT6 ID275
T6SS typei3
Gene symbol-
Locus tagBphy_6109
StrainBurkholderia phymatum STM815
Repliconplasmid pBPHY01 [GenBank: NC_010625] [Browse all T6SS(s) in this replicon]
Location [Strand]659734..661077 [-]
Producthypothetical protein
NoteTssL
UniProt IDB2JW39
KEGG IDbph:Bphy_6109
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 5.50E-63, Aligned region: 44..278
OmpA [PF00691], Evalue: 2.40E-16, Aligned region: 337..435
Protein Sequence: 447 a.a.     [Download]
>gi|186470894|ref|YP_001862212.1| unnamed protein product [Burkholderia phymatum STM815]
MPQATIDPVKQAPDVNEIQATPRRELPHGESLTTRLAAIKAADNPLLEAARPLLRALADMPEYLDHERVE
QLRDLLEQEVRAFQKLCEQTSIRRDHMLGTRYCLCTAIDEAAMQTAWGKNSKVPVQPGQSPRGKDAGAAA
SDINNHDAGVEWVTRGMATIFHEDRQGGDKVYLLIGRLMSDPQEHLDLLEVIYRILSLGFEGRYRFEAGG
HRKHEAVRQRIYNEIMARRGIVPVALSPHWQSDVKGRRASFYDFPVWITVTLLSVILLGCFGWFKYELLG
RSAEVQKQIADIGHMTPPPAPPVLHLKALLKDEIAAGTVSVDEDAHHSSVTFRGDSMFPPGGASVKATMG
PLIAKIAAEIARVPGKVSVLGYTDNVPIRSRQFASNDALSEERATQVMQILQAAGVPASRLEAVGKGDAD
PVADNSTPQGRAQNRRVEITVAEYTRP
 
Nucleotide Sequence: 1344 bp     [Download]
>gi|186470346|ref|NC_010625.1|:c661077-659734 Burkholderia phymatum STM815 plasmid pBPHY01, complete sequence
ATGCCACAGGCAACGATAGATCCCGTGAAGCAAGCCCCGGACGTCAACGAAATCCAGGCAACGCCCCGCC
GCGAATTGCCGCACGGCGAGTCTCTCACAACACGTCTTGCGGCCATCAAGGCCGCGGACAATCCGTTGCT
TGAAGCCGCGCGTCCCCTGCTGCGGGCTCTGGCCGACATGCCGGAGTATCTCGATCATGAGCGGGTCGAG
CAACTGCGCGACCTGCTGGAGCAGGAGGTACGTGCCTTCCAGAAGCTGTGCGAGCAGACCAGCATCCGGC
GGGACCACATGCTCGGCACCCGCTACTGCCTATGTACGGCCATCGACGAGGCGGCCATGCAGACCGCGTG
GGGCAAGAACAGCAAGGTGCCCGTACAGCCAGGACAGAGTCCGCGCGGAAAGGATGCGGGTGCGGCAGCC
TCGGATATCAACAACCACGACGCGGGCGTCGAATGGGTAACCCGTGGGATGGCCACGATCTTCCATGAAG
ATCGGCAAGGCGGCGACAAGGTGTACCTCCTCATCGGCCGGCTGATGTCCGATCCGCAGGAGCATCTTGA
CCTGCTCGAAGTGATCTATCGCATCCTGAGTCTGGGCTTCGAAGGCCGCTACCGCTTTGAAGCGGGTGGC
CACCGCAAGCACGAAGCGGTGCGTCAGCGCATCTACAACGAAATCATGGCGAGACGCGGCATCGTGCCCG
TCGCCCTGTCGCCGCACTGGCAGTCCGACGTCAAGGGCCGGCGTGCGTCGTTCTACGACTTTCCGGTATG
GATCACGGTCACGCTGCTTTCGGTCATCCTGCTCGGCTGCTTTGGGTGGTTCAAGTACGAGCTGCTCGGT
CGCAGCGCTGAGGTCCAGAAGCAGATTGCCGACATTGGACACATGACGCCACCGCCGGCGCCTCCAGTCC
TGCACCTGAAGGCGTTGCTCAAGGACGAAATTGCCGCGGGCACGGTCAGTGTCGACGAAGACGCGCATCA
CAGTTCGGTGACGTTCCGCGGCGATTCGATGTTCCCGCCAGGTGGTGCTTCCGTGAAGGCAACGATGGGC
CCGCTCATCGCGAAGATTGCTGCCGAGATTGCCAGGGTACCCGGCAAGGTTTCGGTGCTGGGCTATACGG
ACAATGTGCCGATCAGAAGCCGCCAGTTCGCATCGAATGACGCACTGTCCGAAGAGCGCGCTACGCAGGT
CATGCAGATTCTGCAGGCTGCCGGCGTGCCGGCAAGCCGCCTGGAGGCCGTTGGCAAGGGCGACGCCGAT
CCGGTCGCTGATAACAGCACGCCCCAGGGCCGCGCACAGAATCGACGTGTCGAAATCACGGTCGCGGAAT
ATACGAGACCATAA