SecReT6
Protein ID: 186470895
SecReT6 ID275
T6SS typei3
Gene symbol-
Locus tagBphy_6110
StrainBurkholderia phymatum STM815
Repliconplasmid pBPHY01 [GenBank: NC_010625] [Browse all T6SS(s) in this replicon]
Location [Strand]661145..662491 [-]
Producttype VI secretion protein
NoteTssK
UniProt IDB2JW40
KEGG IDbph:Bphy_6110
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 4.50E-148, Aligned region: 20..447
Protein Sequence: 448 a.a.     [Download]
>gi|186470895|ref|YP_001862213.1| unnamed protein product [Burkholderia phymatum STM815]
MSWHNKVVWNEGLFMRPQLFQQQERYLEHFAHKRAAPLSPFFFGFTHYTLDTEALALGKVIVKSVAGVFP
DGTPFDAPGSTPPPAPLTIRPEHLEQLIYLAVPIRVPNGEETTFDNASDSLARYAVFNTDLRDTNSVGQG
SQKIQLSNLRLRLVPEKEMTDAWIGLALTRVKTIRADGSIVLDDTLVPPVSAYGASSLLESWLAKIHDLT
RLRATALAQRLTGADGKAGTAAEVSDYLLLQTLNRYEPLLQHLRRVPTTSPADLYALLISMAGELSTYVR
TTTRRPLDSHPAYQHTAPHVCLKPVVDDTHQLLNAVLVRSAQSIELTDTGYGMRNAVVDPAEMHGFTSVV
LGVSAAMPPDTLQQQFAAQAKVGPSERLPDLVRGHLPGITLQALPVPPRQIPFNAGYIYYELSRAGQLWE
DVERRGGLALHIAGDFPSLKLELWGIRG
 
Nucleotide Sequence: 1347 bp     [Download]
>gi|186470346|ref|NC_010625.1|:c662491-661145 Burkholderia phymatum STM815 plasmid pBPHY01, complete sequence
ATGAGCTGGCACAACAAGGTCGTCTGGAATGAGGGGCTCTTCATGCGCCCGCAACTATTCCAGCAGCAGG
AGCGTTATCTCGAGCATTTCGCGCACAAGCGCGCGGCCCCCCTTTCGCCCTTCTTCTTTGGCTTTACGCA
CTACACCCTCGACACCGAGGCGCTCGCGCTCGGCAAGGTGATCGTGAAGTCCGTGGCCGGCGTTTTTCCG
GATGGCACCCCTTTCGATGCACCAGGCAGCACGCCCCCGCCCGCGCCGCTCACGATCCGGCCCGAGCATC
TGGAGCAGCTCATCTATCTCGCTGTGCCGATCCGTGTCCCCAACGGCGAGGAAACGACTTTCGACAACGC
GTCGGACTCTCTCGCACGCTACGCTGTGTTCAACACGGACCTGCGCGACACCAACTCGGTCGGTCAAGGT
TCACAGAAAATCCAGCTGTCGAACCTGCGGCTGCGTCTCGTGCCCGAGAAGGAGATGACCGATGCGTGGA
TTGGCCTTGCGCTCACGCGCGTCAAGACCATTCGCGCCGACGGCAGCATTGTGCTCGACGACACCCTCGT
GCCGCCTGTCTCAGCCTACGGCGCAAGCAGCCTGCTCGAGAGCTGGCTTGCGAAAATCCATGACCTCACC
CGCCTGCGCGCCACGGCGCTCGCGCAGCGTCTGACCGGTGCAGACGGCAAGGCCGGCACCGCGGCCGAGG
TGTCGGACTACCTGCTGCTGCAGACACTCAACCGCTACGAACCGCTATTACAGCATCTGCGGCGGGTGCC
GACCACCTCGCCTGCGGACCTGTACGCCCTGCTCATCAGCATGGCGGGCGAGCTGTCAACCTATGTCCGC
ACCACGACGCGGCGGCCGCTTGATTCGCATCCGGCGTACCAGCACACGGCGCCCCATGTATGCCTGAAGC
CCGTCGTCGACGACACCCACCAGTTGCTCAACGCCGTGCTTGTGCGCAGTGCGCAGAGCATCGAACTGAC
GGATACCGGCTACGGCATGCGCAATGCCGTGGTGGATCCGGCGGAAATGCATGGGTTCACCTCGGTCGTG
CTCGGGGTCAGCGCCGCGATGCCGCCCGATACGCTGCAGCAGCAGTTCGCTGCACAGGCCAAGGTCGGTC
CTTCCGAACGCCTGCCTGATCTCGTGCGGGGTCACCTGCCAGGTATCACGCTGCAGGCATTGCCGGTGCC
ACCGCGGCAGATCCCGTTCAATGCGGGCTACATCTACTACGAACTCTCACGCGCCGGTCAGCTCTGGGAA
GACGTCGAACGCCGTGGCGGTCTGGCACTGCACATCGCGGGGGACTTCCCGTCGCTGAAGCTCGAATTGT
GGGGCATTCGCGGGTAA