SecReT6
Protein ID: 186470896
SecReT6 ID275
T6SS typei3
Gene symbol-
Locus tagBphy_6111
StrainBurkholderia phymatum STM815
Repliconplasmid pBPHY01 [GenBank: NC_010625] [Browse all T6SS(s) in this replicon]
Location [Strand]662515..663021 [-]
Producthypothetical protein
NoteTssJ
UniProt IDB2JW41
KEGG IDbph:Bphy_6111
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.90E-42, Aligned region: 13..160
Protein Sequence: 168 a.a.     [Download]
>gi|186470896|ref|YP_001862214.1| unnamed protein product [Burkholderia phymatum STM815]
MRLIPLATACTLVLLLAACASSDPKLHDPLRLDLTVSAATTVNPDGQGRAAPIVVRVYELKTDNAFKAAD
YFSVQDRDKTVLADDLVKRDEFQLRPGEHQTIRRIADPGTTTLGVLAEYRDLPHAVWRTVYPLPATPEKA
WYRFSSPKLNLTINLDAGAIRITDNTKK
 
Nucleotide Sequence: 507 bp     [Download]
>gi|186470346|ref|NC_010625.1|:c663021-662515 Burkholderia phymatum STM815 plasmid pBPHY01, complete sequence
ATGCGCCTGATTCCTCTCGCGACCGCCTGCACACTTGTGCTGCTGCTCGCCGCCTGCGCGAGCAGCGATC
CCAAACTGCATGATCCACTGCGGCTGGACCTGACGGTCAGTGCCGCCACAACGGTCAATCCTGATGGTCA
GGGACGGGCCGCGCCCATCGTGGTGCGTGTCTATGAACTGAAGACCGATAACGCGTTCAAGGCAGCGGAC
TATTTCTCCGTGCAGGACAGGGACAAGACGGTGCTCGCGGATGATCTCGTCAAACGCGACGAGTTCCAGT
TGCGGCCCGGCGAGCATCAGACGATCCGGCGCATCGCCGATCCGGGCACGACCACGCTGGGTGTGCTCGC
CGAATACCGCGATCTGCCGCATGCCGTCTGGCGCACCGTGTATCCGTTACCCGCGACACCGGAGAAGGCG
TGGTACCGCTTCTCGTCGCCGAAGCTGAATCTGACCATCAATCTTGACGCGGGTGCGATCAGGATTACTG
ATAACACGAAGAAGTAA