SecReT6
Protein ID: 186470898
SecReT6 ID275
T6SS typei3
Gene symbol-
Locus tagBphy_6113
StrainBurkholderia phymatum STM815
Repliconplasmid pBPHY01 [GenBank: NC_010625] [Browse all T6SS(s) in this replicon]
Location [Strand]663703..665196 [-]
ProductEvpB family type VI secretion protein
NoteTssC
UniProt IDB2JW43
KEGG IDbph:Bphy_6113
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 2.60E-193, Aligned region: 6..49
DUF877 [PF05943], Evalue: 2.60E-193, Aligned region: 65..491
Protein Sequence: 497 a.a.     [Download]
>gi|186470898|ref|YP_001862216.1| unnamed protein product [Burkholderia phymatum STM815]
MAKQHAQTAVAGVATGSDFTQLLNQEFRPKTQQAREAVELAVQTLAEQALRQSATISDDAYKSIAAIIAQ
IDHKLSEQINLILHHDDYQKLESAWRGLHHLVSNTETDERLKIRFMDISKDELRRTMKRYKGLAWDQSPL
FKQIYEEEYGQLGGEPYGCLVADYYFDHTPPDVDLLGSIAKISAAAHTPFISGASPAVLQMESWQELANP
RDLTKIFTQNLEYAPWNSLRNTEDARYIGLAMPRFLARLPYGAKTNPVDEFDFEEDTAGSDHRHYAWSNA
AYAMGVNINRSFKLYGWCSLIRGVESGGTVENLPCHTFPTDDGGVDMKCPTEIAISDRREAELSKNGFIP
LIHRKNTDHATFIGAQSMQKPAEYHDADATANANLSARLPYLFACSRFAHYLKCIVRDKIGAFKEREDMQ
RWLNEWIMNYVDADPANSSQETKARRPLAAAEVLVEEVEGNPGYYQAKFFLRPHFQLEGLTVSLRLVAKL
PSIKEAA
 
Nucleotide Sequence: 1494 bp     [Download]
>gi|186470346|ref|NC_010625.1|:c665196-663703 Burkholderia phymatum STM815 plasmid pBPHY01, complete sequence
ATGGCAAAACAGCATGCACAGACAGCGGTGGCCGGCGTCGCAACCGGTTCGGACTTCACCCAGTTGCTCA
ACCAGGAATTCCGGCCGAAGACCCAACAGGCACGCGAAGCCGTCGAACTCGCCGTCCAGACGCTCGCCGA
ACAGGCGCTCCGTCAATCAGCCACCATCAGCGACGATGCGTACAAGAGCATCGCGGCCATCATTGCACAG
ATCGATCACAAGCTCTCCGAGCAGATCAACCTGATCCTGCACCACGACGATTACCAGAAGCTGGAATCGG
CCTGGCGTGGTCTGCATCACCTCGTCTCCAATACGGAAACGGATGAGCGCCTGAAGATCCGCTTCATGGA
CATCTCGAAGGACGAGCTGCGCCGCACGATGAAGCGCTACAAGGGCCTCGCATGGGACCAGAGCCCGCTC
TTCAAGCAGATCTACGAAGAAGAGTACGGCCAGCTCGGTGGCGAGCCGTACGGCTGTCTCGTCGCGGACT
ACTACTTCGACCACACACCGCCGGACGTCGACCTGCTCGGCTCGATCGCCAAGATCTCGGCCGCAGCCCA
CACCCCGTTCATCTCGGGCGCGTCGCCCGCCGTGCTGCAGATGGAATCGTGGCAGGAGCTCGCCAATCCG
CGCGACCTCACGAAGATCTTCACGCAGAACCTCGAATATGCCCCGTGGAACTCGCTACGCAACACCGAGG
ACGCGCGCTATATCGGTCTTGCGATGCCGCGCTTCCTGGCGCGCCTGCCGTATGGGGCAAAAACGAACCC
GGTCGACGAATTCGACTTCGAGGAAGACACCGCGGGCTCGGATCACCGTCACTACGCATGGTCCAACGCG
GCCTACGCGATGGGCGTGAACATCAACCGCTCGTTCAAGCTGTACGGCTGGTGCTCGCTGATCCGCGGCG
TGGAATCGGGTGGCACGGTCGAAAACCTGCCCTGCCACACGTTCCCGACGGACGATGGCGGCGTCGACAT
GAAGTGCCCGACCGAAATCGCCATCTCGGATCGCCGCGAGGCGGAGCTGTCGAAGAACGGTTTCATCCCG
CTCATTCACCGCAAGAACACCGACCACGCGACCTTCATCGGTGCGCAGTCGATGCAGAAGCCGGCCGAGT
ACCACGATGCTGACGCAACCGCTAACGCGAACCTGTCCGCGCGCCTGCCGTACCTGTTCGCCTGCTCGCG
TTTCGCGCATTACTTGAAGTGCATCGTGCGAGACAAGATCGGTGCGTTCAAGGAGCGTGAGGACATGCAG
CGCTGGCTCAACGAATGGATCATGAACTACGTTGACGCCGACCCGGCCAACTCGTCGCAGGAAACCAAGG
CCCGTCGTCCGCTCGCCGCAGCCGAGGTGCTCGTCGAGGAAGTGGAAGGCAACCCTGGCTACTACCAGGC
GAAGTTCTTCCTGCGTCCGCACTTCCAGCTCGAAGGCCTGACCGTGTCACTGCGCTTGGTCGCGAAGCTG
CCGTCGATCAAGGAAGCCGCCTGA