SecReT6
Protein ID: 186470899
SecReT6 ID275
T6SS typei3
Gene symbol-
Locus tagBphy_6114
StrainBurkholderia phymatum STM815
Repliconplasmid pBPHY01 [GenBank: NC_010625] [Browse all T6SS(s) in this replicon]
Location [Strand]665221..665754 [-]
Producttype VI secretion protein
NoteTssB
UniProt IDB2JW44
KEGG IDbph:Bphy_6114
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 9.10E-60, Aligned region: 10..163
Protein Sequence: 177 a.a.     [Download]
>gi|186470899|ref|YP_001862217.1| unnamed protein product [Burkholderia phymatum STM815]
MSSSSSQKFIARNRAPRVQIEYDVEVYGSEKKVELPFVMGVLADLSGKPVDPLPAVADRRFLDIDIDNFD
ERMKAIRPRVAFAVPSTLTGEGQMMVDMTFESIEDFSPAAIARKVEPLRQLLEARTQLANLQTYMDGKSG
AESLVNQLLQDPSLLKSLAAAPKPQAAVDTPEASDTN
 
Nucleotide Sequence: 534 bp     [Download]
>gi|186470346|ref|NC_010625.1|:c665754-665221 Burkholderia phymatum STM815 plasmid pBPHY01, complete sequence
ATGTCTTCCAGCAGTTCGCAGAAGTTCATCGCACGCAACCGCGCACCACGTGTGCAGATCGAGTATGACG
TCGAGGTCTATGGCTCCGAAAAGAAGGTCGAACTCCCGTTCGTGATGGGCGTGCTCGCCGATCTCTCGGG
CAAGCCGGTCGACCCTCTGCCCGCTGTGGCAGACCGCCGCTTCCTCGATATTGATATTGACAATTTTGAT
GAACGCATGAAAGCCATCCGGCCGCGCGTCGCGTTTGCCGTGCCGAGCACGCTCACCGGCGAAGGCCAGA
TGATGGTCGACATGACCTTCGAAAGCATCGAGGACTTCTCGCCTGCGGCCATCGCGCGCAAGGTCGAACC
GCTTCGACAACTGCTTGAGGCGCGCACGCAACTCGCGAACCTGCAAACGTACATGGACGGCAAGTCGGGC
GCGGAATCGCTCGTGAACCAGCTGCTTCAGGATCCCTCGCTTCTGAAGTCACTGGCCGCCGCACCGAAAC
CGCAGGCCGCCGTTGACACTCCGGAAGCCAGCGACACGAACTGA