SecReT6
Protein ID: 186470900
SecReT6 ID275
T6SS typei3
Gene symbol-
Locus tagBphy_6115
StrainBurkholderia phymatum STM815
Repliconplasmid pBPHY01 [GenBank: NC_010625] [Browse all T6SS(s) in this replicon]
Location [Strand]665804..668524 [-]
Producttype VI secretion ATPase
NoteTssH
UniProt IDB2JW45
KEGG IDbph:Bphy_6115
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.80E-38, Aligned region: 232..309
AAA_2 [PF07724], Evalue: 1.80E-38, Aligned region: 608..774
AAA [PF00004], Evalue: 2.10E-19, Aligned region: 232..363
AAA [PF00004], Evalue: 2.10E-19, Aligned region: 613..697
AAA_5 [PF07728], Evalue: 5.40E-14, Aligned region: 232..310
AAA_5 [PF07728], Evalue: 5.40E-14, Aligned region: 336..362
AAA_5 [PF07728], Evalue: 5.40E-14, Aligned region: 454..500
AAA_5 [PF07728], Evalue: 5.40E-14, Aligned region: 612..731
ClpB_D2-small [PF10431], Evalue: 5.90E-14, Aligned region: 783..851
AAA_22 [PF13401], Evalue: 5.70E-08, Aligned region: 232..318
AAA_22 [PF13401], Evalue: 5.70E-08, Aligned region: 367..400
AAA_22 [PF13401], Evalue: 5.70E-08, Aligned region: 611..634
AAA_22 [PF13401], Evalue: 5.70E-08, Aligned region: 674..699
Sigma54_activat [PF00158], Evalue: 1.70E-07, Aligned region: 228..312
Sigma54_activat [PF00158], Evalue: 1.70E-07, Aligned region: 612..711
AAA_16 [PF13191], Evalue: 2.10E-07, Aligned region: 32..73
AAA_16 [PF13191], Evalue: 2.10E-07, Aligned region: 209..247
AAA_16 [PF13191], Evalue: 2.10E-07, Aligned region: 273..310
AAA_16 [PF13191], Evalue: 2.10E-07, Aligned region: 457..515
AAA_16 [PF13191], Evalue: 2.10E-07, Aligned region: 600..654
AAA_16 [PF13191], Evalue: 2.10E-07, Aligned region: 677..700
AAA_16 [PF13191], Evalue: 2.10E-07, Aligned region: 757..808
AAA_19 [PF13245], Evalue: 8.60E-07, Aligned region: 230..258
AAA_19 [PF13245], Evalue: 8.60E-07, Aligned region: 610..634
AAA_25 [PF13481], Evalue: 1.60E-05, Aligned region: 232..271
AAA_25 [PF13481], Evalue: 1.60E-05, Aligned region: 610..638
AAA_17 [PF13207], Evalue: 4.10E-05, Aligned region: 86..87
AAA_17 [PF13207], Evalue: 4.10E-05, Aligned region: 233..245
AAA_17 [PF13207], Evalue: 4.10E-05, Aligned region: 442..493
AAA_17 [PF13207], Evalue: 4.10E-05, Aligned region: 612..649
AAA_29 [PF13555], Evalue: 4.20E-05, Aligned region: 224..249
AAA_29 [PF13555], Evalue: 4.20E-05, Aligned region: 609..637
IstB_IS21 [PF01695], Evalue: 7.20E-05, Aligned region: 223..254
IstB_IS21 [PF01695], Evalue: 7.20E-05, Aligned region: 612..632
IstB_IS21 [PF01695], Evalue: 7.20E-05, Aligned region: 684..746
NACHT [PF05729], Evalue: 0.00023, Aligned region: 232..260
NACHT [PF05729], Evalue: 0.00023, Aligned region: 612..639
Zeta_toxin [PF06414], Evalue: 0.0003, Aligned region: 232..251
Zeta_toxin [PF06414], Evalue: 0.0003, Aligned region: 605..652
AAA_14 [PF13173], Evalue: 0.00045, Aligned region: 232..313
AAA_14 [PF13173], Evalue: 0.00045, Aligned region: 611..699
AAA_18 [PF13238], Evalue: 0.00066, Aligned region: 232..248
AAA_18 [PF13238], Evalue: 0.00066, Aligned region: 613..643
Clp_N [PF02861], Evalue: 0.0021, Aligned region: 26..67
RuvB_N [PF05496], Evalue: 0.0057, Aligned region: 231..245
RuvB_N [PF05496], Evalue: 0.0057, Aligned region: 301..312
RuvB_N [PF05496], Evalue: 0.0057, Aligned region: 574..633
RuvB_N [PF05496], Evalue: 0.0057, Aligned region: 681..705
Arch_ATPase [PF01637], Evalue: 0.007, Aligned region: 210..247
Arch_ATPase [PF01637], Evalue: 0.007, Aligned region: 284..315
Arch_ATPase [PF01637], Evalue: 0.007, Aligned region: 611..650
Protein Sequence: 906 a.a.     [Download]
>gi|186470900|ref|YP_001862218.1| unnamed protein product [Burkholderia phymatum STM815]
MTISRQSLFSKLGVTLFRSAESATAYCKLRGNPYVELVHWLHQLMQQPDSDLHRVLRHCEIDQDTLDRDM
ARALAGLPAGASSIIDFSHDVDHAIERGWLITSLDRNERRIRGAWLLVALLTTPELRRALLSISPAFAKI
PVDGLSDVLPAWIDGSPEMGEAPHDSSDYSPALPGEASQAMPRTSKGSPLEQYCTDLTARARAGEIDPVV
GRELEIRTMIDVLLRRRQNNPLLTGEAGVGKTAVVEGFALAVANGEVPPKLASVRLLSLDVGALLAGASM
KGEFEARLKGVLEAAAKSQVSVILFVDEIHTLIGAGGQAGTGDAANLLKPALARGTIRTIGATTWAEYKR
HIEKDPALTRRFQVLQVPEPEEVAAIDMVRGLAPTFARHHGVVILDEAIRAAVRFSHRYIPSRQLPDKAI
SLFDTACARVALSQHTPPRELQNLSERLRAATVERDLLQQEALIGLDADQAIASANARIEALTNDMAVVE
GHWRAQLDAMQALASAREAALAGDQQAAGSLRDLEQQLTFLRGETPYVFPEVDEAIVAEIVSDWTGVPVG
RMVTDEITAVRTLPSTLEARVIGQPDALHQIGERVQTARAGLTNPKKPLGVFLLAGPSGVGKTETALALA
EALYGGEQNLITLNMSEYQEAHTVSGLKGAPPGYVGYGEGGVLTEAVRRRPYSVVLLDEIEKAHRDVHEM
FFQVFDKGYMEDGDGRYIDFRNTTILLTSNVGSELTASLCADPALAPDTEALRAALAPELLKVFPAAFLG
RITVVPYRPLASMSLARIVRLHLERVVRRMAETHQIVLNYEEAVVDYIVGRCLVQETGARVLIGFIEQHV
LPRLSTLWLDAFSSKQPLSRIDIVLGDRDAPPATALLFRFPAAQQQASQTDGVNADAEESIVGQAL
 
Nucleotide Sequence: 2721 bp     [Download]
>gi|186470346|ref|NC_010625.1|:c668524-665804 Burkholderia phymatum STM815 plasmid pBPHY01, complete sequence
ATGACGATTTCCCGTCAGTCCCTGTTCAGCAAGCTGGGAGTCACGTTGTTCAGGAGTGCTGAATCTGCAA
CGGCGTACTGTAAACTCAGAGGCAATCCCTACGTCGAGCTGGTGCACTGGTTGCACCAGCTTATGCAGCA
GCCTGATTCTGACCTGCATCGTGTGCTGCGTCATTGTGAAATTGATCAGGACACGCTGGATCGTGACATG
GCCCGTGCACTTGCGGGGTTGCCGGCAGGTGCCAGTTCCATTATCGATTTTTCGCACGATGTCGATCACG
CCATCGAGCGTGGCTGGCTCATCACATCGCTCGACAGGAATGAACGGCGTATTCGCGGCGCCTGGTTGCT
GGTCGCCCTTCTGACGACGCCCGAACTGCGGCGTGCGCTGCTTTCCATTTCACCGGCCTTCGCCAAGATT
CCCGTAGACGGATTGAGCGATGTGCTGCCGGCGTGGATTGATGGTTCGCCCGAAATGGGCGAAGCCCCGC
ACGATAGCAGCGACTACTCCCCCGCCCTTCCCGGCGAAGCCTCCCAGGCCATGCCGCGTACTTCAAAAGG
CTCGCCACTTGAACAGTACTGCACCGACCTGACGGCACGCGCACGTGCTGGCGAGATCGACCCCGTGGTG
GGGCGCGAACTCGAGATCCGCACGATGATCGATGTGCTGCTGCGTCGCCGCCAGAACAACCCGCTGCTCA
CGGGTGAAGCCGGCGTTGGCAAAACCGCTGTTGTAGAAGGGTTCGCACTCGCAGTCGCCAACGGTGAAGT
CCCCCCCAAACTCGCCAGTGTGCGCTTGCTGAGCCTCGACGTCGGTGCCCTCCTTGCCGGCGCCAGCATG
AAGGGCGAATTCGAGGCGCGCCTGAAAGGCGTGCTTGAAGCTGCCGCAAAGTCGCAGGTTTCGGTGATTC
TTTTCGTGGATGAAATCCATACGCTGATCGGTGCAGGTGGTCAGGCAGGCACGGGCGACGCCGCCAACCT
CCTCAAGCCGGCGCTCGCACGCGGTACGATTCGCACCATCGGCGCGACAACGTGGGCCGAGTACAAGCGG
CACATTGAGAAGGATCCTGCGCTCACCCGCCGCTTCCAGGTCCTTCAGGTTCCGGAGCCGGAGGAAGTGG
CCGCCATCGACATGGTGCGCGGTCTCGCGCCAACGTTTGCCCGGCATCATGGTGTCGTCATTCTCGACGA
AGCGATTCGTGCCGCGGTGAGGTTTTCGCATCGCTACATTCCCTCGCGGCAGTTGCCCGACAAGGCGATC
AGCCTGTTCGATACGGCCTGCGCCCGCGTGGCGCTCTCGCAGCATACGCCACCGCGCGAACTGCAAAACC
TGTCCGAGCGTCTGCGTGCGGCCACGGTCGAGCGCGACCTGCTCCAGCAGGAAGCGCTCATCGGTCTGGA
TGCGGATCAGGCCATCGCCTCTGCGAACGCGCGCATCGAAGCCCTGACAAACGACATGGCCGTTGTCGAA
GGACACTGGCGCGCCCAGCTCGACGCCATGCAGGCGCTTGCGAGCGCGCGTGAGGCAGCGCTCGCCGGCG
ATCAGCAGGCAGCAGGTTCCTTGCGTGATCTTGAGCAACAGCTCACATTCCTCCGGGGCGAGACGCCTTA
TGTATTCCCGGAAGTCGATGAAGCCATTGTCGCGGAAATCGTGTCGGACTGGACCGGCGTCCCCGTCGGG
CGCATGGTGACTGACGAGATCACGGCCGTTCGCACACTGCCCTCAACGCTCGAAGCGAGGGTCATCGGCC
AACCCGATGCGCTCCACCAGATCGGCGAGCGCGTGCAGACGGCGCGTGCCGGCCTCACGAACCCGAAGAA
GCCCCTTGGCGTGTTCCTGCTCGCGGGCCCTTCCGGTGTCGGCAAGACCGAGACGGCGCTCGCCCTTGCT
GAAGCGCTGTATGGCGGCGAGCAGAACCTGATCACCCTCAACATGAGCGAGTATCAGGAAGCTCACACGG
TCTCGGGGCTCAAGGGCGCGCCACCGGGTTACGTCGGTTACGGCGAGGGCGGCGTACTGACCGAAGCCGT
GCGACGCCGCCCGTATTCGGTGGTGCTGCTCGACGAGATCGAGAAGGCGCATCGCGACGTCCACGAAATG
TTCTTCCAGGTGTTCGACAAGGGCTACATGGAAGATGGTGACGGGCGGTATATCGACTTCCGCAATACCA
CGATCCTGCTTACCAGCAACGTGGGCTCGGAGCTGACGGCAAGCCTGTGTGCGGACCCGGCGCTTGCACC
GGATACAGAGGCCTTGCGTGCTGCGCTCGCCCCCGAACTGCTCAAGGTGTTCCCGGCCGCATTCCTTGGT
CGCATCACCGTCGTGCCATACCGGCCGCTCGCCAGCATGTCACTCGCGCGCATCGTCAGGCTGCACCTGG
AGCGCGTCGTGCGCCGCATGGCCGAGACACACCAGATCGTACTGAACTACGAGGAGGCTGTCGTCGATTA
CATCGTCGGTCGATGTCTCGTGCAGGAGACGGGTGCACGTGTGCTGATCGGCTTCATCGAGCAGCACGTC
CTGCCGCGTCTTTCTACCCTGTGGCTCGATGCCTTTTCGTCGAAGCAGCCGCTCTCACGCATCGATATTG
TCCTGGGCGATCGTGACGCTCCGCCTGCTACCGCGCTGCTGTTCCGGTTCCCGGCTGCGCAGCAGCAGGC
CAGCCAGACCGATGGCGTCAACGCTGACGCCGAGGAATCCATCGTCGGGCAGGCTCTCTGA