SecReT6
Protein ID: 186470902
SecReT6 ID275
T6SS typei3
Gene symbol-
Locus tagBphy_6117
StrainBurkholderia phymatum STM815
Repliconplasmid pBPHY01 [GenBank: NC_010625] [Browse all T6SS(s) in this replicon]
Location [Strand]669629..670495 [+]
Productvirulence protein SciE type
NoteTagJ
UniProt IDB2JW47
KEGG IDbph:Bphy_6117
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 6.70E-48, Aligned region: 52..71
ImpE [PF07024], Evalue: 6.70E-48, Aligned region: 134..261
Protein Sequence: 288 a.a.     [Download]
>gi|186470902|ref|YP_001862220.1| unnamed protein product [Burkholderia phymatum STM815]
MTMSRVSLATRLDDVQGMIRREPTAAGHRWTLFQLLCVTQQWERAVQQLQVFAQLNPQQVQAAQAYRDLI
RAERWRTKVLDGLAQPGFVIGPPSWVENLAEALRLTAAGQSDAADAIRESALDQAPLVRGGGANHSFEWI
ADSDSRLGPVCEIITAGRYRWLPFSDIAAWEIGRPATMVDFVWAPCLLTLVDGATVRGFMPARFPSVADA
TYDSAVLDALRLGNMTIWTDAGLTGVLAEGRKTWATSAGDVGLFELDVCTFGCDADRGSVDSVDGMAMQD
EGGVDGAA
 
Nucleotide Sequence: 867 bp     [Download]
>gi|186470346|ref|NC_010625.1|:669629-670495 Burkholderia phymatum STM815 plasmid pBPHY01, complete sequence
ATGACGATGTCGCGCGTATCGCTCGCCACACGCCTGGATGACGTGCAGGGCATGATTCGCCGGGAACCCA
CCGCTGCAGGTCACCGCTGGACCTTGTTCCAGCTGCTCTGCGTGACGCAGCAGTGGGAGCGGGCGGTCCA
GCAACTGCAGGTTTTCGCGCAATTGAATCCCCAGCAGGTGCAGGCTGCACAGGCGTACCGCGACCTGATC
CGCGCCGAACGGTGGCGCACGAAGGTCCTGGATGGACTTGCGCAGCCTGGTTTTGTTATCGGTCCCCCAT
CGTGGGTCGAAAATCTCGCTGAGGCGCTGCGTCTGACGGCGGCTGGGCAAAGTGATGCCGCCGACGCCAT
TCGTGAATCAGCGCTGGATCAAGCGCCGCTCGTGCGCGGCGGCGGAGCAAATCATTCGTTTGAGTGGATC
GCCGACAGCGATTCACGTCTCGGCCCTGTCTGCGAAATCATCACGGCAGGACGCTACCGCTGGCTGCCTT
TTTCCGATATTGCGGCTTGGGAAATCGGGCGTCCGGCGACGATGGTTGATTTCGTCTGGGCACCGTGCCT
GCTCACGCTCGTCGACGGTGCCACGGTTCGTGGGTTTATGCCCGCGCGTTTCCCGTCCGTCGCGGACGCG
ACGTACGACAGCGCCGTTCTCGATGCGCTGCGCCTCGGCAATATGACGATCTGGACGGATGCGGGCCTCA
CCGGTGTGCTCGCGGAAGGCCGCAAGACGTGGGCAACCAGTGCCGGCGATGTGGGACTGTTCGAGCTGGA
TGTCTGTACGTTTGGCTGTGACGCGGACCGTGGGTCGGTCGACAGCGTTGACGGGATGGCAATGCAGGAT
GAAGGGGGCGTCGATGGAGCGGCGTAG