SecReT6
Protein ID: 186470903
SecReT6 ID275
T6SS typei3
Gene symbol-
Locus tagBphy_6118
StrainBurkholderia phymatum STM815
Repliconplasmid pBPHY01 [GenBank: NC_010625] [Browse all T6SS(s) in this replicon]
Location [Strand]670482..671033 [+]
Producttype VI secretion system lysozyme-like protein
NoteTssE
UniProt IDB2JW48
KEGG IDbph:Bphy_6118
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 7.10E-18, Aligned region: 49..160
Protein Sequence: 183 a.a.     [Download]
>gi|186470903|ref|YP_001862221.1| unnamed protein product [Burkholderia phymatum STM815]
MERRRRKADGTQTASTPRRHDTFLMPTLLDRLRDDAPHRQHEAPGEYAVTRAQMRDIVQRDLAYLLNTTN
IEEQVDRARYPEAAASTVNFGVPPLAGKFTATRQWADIEIIIKQAITDFEPRLVPGSLSVAPLPDKDGEV
QYNALAFEVRGLISMDPYPLEFLVQSSLDLETSQLNVSGARAV
 
Nucleotide Sequence: 552 bp     [Download]
>gi|186470346|ref|NC_010625.1|:670482-671033 Burkholderia phymatum STM815 plasmid pBPHY01, complete sequence
ATGGAGCGGCGTAGACGCAAAGCCGACGGCACGCAGACCGCCAGCACGCCCCGGCGGCACGATACTTTTC
TAATGCCCACGCTGCTGGACCGGCTGCGGGATGACGCACCACACCGGCAGCACGAGGCGCCCGGCGAGTA
TGCCGTGACGCGCGCGCAGATGCGCGACATCGTCCAGCGCGATCTGGCGTACCTGCTCAACACGACCAAC
ATCGAGGAGCAGGTTGATCGGGCACGTTACCCCGAGGCCGCAGCATCGACCGTGAATTTCGGGGTGCCGC
CGCTGGCCGGTAAGTTCACGGCCACCCGTCAATGGGCCGACATCGAAATCATCATCAAACAGGCAATTAC
GGATTTCGAGCCGCGTCTCGTACCGGGCAGCCTCAGCGTGGCGCCGCTACCGGACAAGGATGGCGAAGTT
CAGTACAACGCGCTCGCGTTTGAGGTGCGCGGACTGATCAGCATGGATCCCTACCCCCTGGAATTCCTGG
TGCAGAGTTCACTTGACCTGGAGACCAGCCAGCTTAACGTCAGCGGTGCACGCGCCGTCTGA