SecReT6
Protein ID: 186470904
SecReT6 ID275
T6SS typei3
Gene symbol-
Locus tagBphy_6119
StrainBurkholderia phymatum STM815
Repliconplasmid pBPHY01 [GenBank: NC_010625] [Browse all T6SS(s) in this replicon]
Location [Strand]671060..672949 [+]
Producttype VI secretion protein
NoteTssF
UniProt IDB2JW49
KEGG IDbph:Bphy_6119
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 6.90E-203, Aligned region: 5..628
Protein Sequence: 629 a.a.     [Download]
>gi|186470904|ref|YP_001862222.1| unnamed protein product [Burkholderia phymatum STM815]
MDPRLLEYYNHELIYMRELASEFGRHHPKIGARLGMQAGEIGDPYVERLLESFCFMAARMQIKIDAEFPK
FTGRLLEVIYPNYVAPTPSISVARIYPSPKEGNLNRGFQLPRGTMFKARKPAGEKTLCQFRSGLDVTLYP
LGISEAKLTAIPPDVVGLDRYIPPDRQVRGALRIRFRTTNGSRISDLQGLNHLPIYLAGDEQVASHLFEL
LHAANVALVIGEPGQFGSGDKPLSVVTSNPVAHEGIGIGEGLLPLTWSKFHGHNLLHEYFACPSRFYFFA
LTGLAQGFSRINGPEVEVIVLLDQPTERLANLVDASRFALFCTPVVNLFEKRTDQIEIPQGESEVRLVPS
KLEPLDYEVFAIQKLCGQKTSNSAELEFRPLFQTLNNDEGNYGRYFSSRRERRLASDNSRRYGTRTPYIG
TEMFVTLVDQTEAPYNGDIRYLSADAWVTNRDLPLLVPRNGVDDLDGNDEDSIQSIGLIRPPSPPRPPYA
EREMAWRLIRQLNFNYLPFSDMDHREGGQGLRDLLRLFLASDDTERQRQVEALIGVKTEPVNDMLPGNGP
LVFGRGIECVLTVDETGFSGVSPYLLGLILEHYMARHVSINSFTQTELHSMQRGLVARWPVRMGTRGVA
 
Nucleotide Sequence: 1890 bp     [Download]
>gi|186470346|ref|NC_010625.1|:671060-672949 Burkholderia phymatum STM815 plasmid pBPHY01, complete sequence
ATGGATCCACGACTGCTCGAATATTACAACCACGAATTGATCTATATGCGGGAGCTTGCCAGCGAATTCG
GCCGGCACCACCCCAAGATCGGGGCGCGTCTGGGCATGCAGGCGGGTGAGATCGGCGACCCCTATGTCGA
ACGGCTCCTCGAGTCGTTCTGCTTCATGGCGGCCCGTATGCAGATCAAGATCGACGCGGAGTTCCCGAAG
TTTACCGGGCGGCTCCTTGAAGTCATCTACCCGAACTATGTCGCGCCGACTCCATCCATATCGGTCGCCC
GCATCTATCCCAGTCCGAAGGAAGGGAACCTGAACCGCGGTTTCCAGCTGCCACGTGGCACGATGTTCAA
GGCACGCAAGCCAGCGGGCGAGAAAACCCTGTGCCAGTTCCGCAGCGGGCTGGACGTCACGCTGTATCCG
CTCGGCATTTCCGAAGCGAAACTCACGGCCATTCCACCCGATGTTGTCGGACTCGACCGGTATATTCCGC
CGGATCGCCAGGTCCGGGGCGCCTTGCGCATCCGGTTCCGTACCACGAACGGTTCGCGAATTTCGGATCT
GCAGGGCCTCAACCATTTGCCAATCTACCTTGCAGGTGACGAGCAGGTCGCTTCGCACCTGTTCGAACTG
CTGCACGCGGCCAATGTGGCTCTGGTCATTGGTGAACCAGGGCAGTTCGGTTCGGGCGACAAGCCGCTCT
CGGTCGTCACGTCGAATCCTGTTGCCCATGAGGGTATTGGTATTGGTGAAGGGCTGCTGCCGCTCACCTG
GTCGAAATTCCATGGCCACAATCTTCTGCACGAGTACTTTGCGTGCCCGAGCCGGTTCTATTTCTTTGCG
CTGACGGGTCTCGCGCAAGGATTTAGCCGGATCAACGGGCCCGAAGTCGAGGTGATTGTGCTGCTGGATC
AACCCACCGAACGGCTCGCGAACCTGGTGGATGCGTCGCGTTTTGCACTTTTTTGCACTCCGGTCGTCAA
TCTGTTCGAGAAGCGGACCGACCAGATCGAAATCCCGCAGGGCGAGTCCGAGGTCCGGCTCGTTCCATCG
AAGCTGGAGCCGCTTGACTATGAGGTCTTCGCGATCCAGAAGCTGTGCGGCCAGAAGACGTCGAATTCGG
CTGAACTGGAGTTCCGGCCGCTGTTCCAGACGCTGAACAACGACGAGGGCAATTACGGGCGGTACTTTTC
GAGCCGCCGCGAGCGCCGCCTGGCGTCGGACAACAGTCGGCGATACGGCACGCGCACGCCCTACATCGGT
ACTGAGATGTTCGTCACGCTGGTCGACCAGACCGAAGCGCCCTACAACGGGGACATCCGCTATCTGTCGG
CCGATGCCTGGGTGACCAACCGCGACCTGCCACTGCTCGTGCCTCGCAACGGCGTGGATGACCTCGACGG
CAACGACGAGGACTCGATCCAGTCGATCGGTCTGATCCGGCCACCCAGCCCTCCGCGGCCGCCTTACGCG
GAACGCGAGATGGCTTGGCGCCTGATCCGGCAACTGAACTTCAACTACCTGCCGTTCAGTGACATGGATC
ACCGCGAGGGTGGGCAGGGCCTGCGCGATCTGCTCAGACTGTTCCTTGCCAGCGATGATACCGAACGCCA
GCGTCAGGTCGAAGCTCTCATTGGCGTGAAGACGGAACCCGTCAACGACATGCTGCCGGGCAACGGTCCA
CTCGTGTTCGGGCGTGGTATCGAGTGCGTGCTCACGGTCGATGAGACGGGCTTCTCGGGCGTCAGCCCCT
ACCTGCTCGGCCTGATTCTCGAACACTACATGGCCCGGCACGTGTCGATCAATTCGTTCACGCAAACCGA
GCTGCATTCAATGCAACGGGGGTTGGTCGCCCGTTGGCCGGTACGCATGGGTACGCGTGGAGTGGCCTGA