SecReT6
Protein ID: 186470905
SecReT6 ID275
T6SS typei3
Gene symbol-
Locus tagBphy_6120
StrainBurkholderia phymatum STM815
Repliconplasmid pBPHY01 [GenBank: NC_010625] [Browse all T6SS(s) in this replicon]
Location [Strand]672949..674037 [+]
Producttype VI secretion protein
NoteTssG
UniProt IDB2JW50
KEGG IDbph:Bphy_6120
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.00E-100, Aligned region: 24..325
Protein Sequence: 362 a.a.     [Download]
>gi|186470905|ref|YP_001862223.1| unnamed protein product [Burkholderia phymatum STM815]
MQRAPFKALIQDIALSQSLLDHLQAEPWRHGFFALMRRIGANPAIDPIGTARLPQAEPFRLGQQASLIFA
PREIASVSVDHERLRVLLFGLGMLGPNGPLPIHITEIARERKEHRRDPTLSNFLDIFHHRYLTMLYRVWA
SAQSAASLDRPGNERFTFYIASLTGHEVKEIEQGPLPAHARLSAAPHLIRESRNPDGLAATLSHYFGVPV
KIDEFVFHWLERKPGKRSRLGVPGAATTMAVDGFLGDRIPDRQYRFRIVIGPVDMEDYQRFTPQGSDLLR
LVEWVRAFVGQEIHWELELKIRPHSAPPAVVGGPQQLGWSGWLGQSPSPEPVTGMIFEPERYVPQLKQDA
ETRAARVKQIEP
 
Nucleotide Sequence: 1089 bp     [Download]
>gi|186470346|ref|NC_010625.1|:672949-674037 Burkholderia phymatum STM815 plasmid pBPHY01, complete sequence
ATGCAACGTGCTCCGTTCAAGGCGCTGATCCAGGATATCGCGCTGTCGCAATCGCTGCTCGACCACCTGC
AGGCCGAGCCGTGGCGCCATGGCTTTTTTGCGTTGATGCGCCGTATCGGCGCCAACCCGGCGATTGACCC
GATCGGTACGGCCAGGCTCCCGCAGGCTGAGCCCTTCAGGCTCGGCCAGCAGGCGAGCCTCATCTTTGCG
CCGCGCGAGATCGCAAGTGTCAGCGTGGATCACGAGCGTCTGAGAGTCCTGCTCTTTGGACTGGGCATGC
TTGGTCCCAATGGCCCACTGCCGATCCACATCACCGAGATTGCACGCGAACGCAAGGAGCATCGACGCGA
TCCGACGCTCAGCAATTTCCTCGACATCTTCCATCATCGATATCTCACGATGCTCTACCGCGTGTGGGCG
TCGGCGCAATCCGCAGCGAGTCTGGATCGGCCCGGGAACGAGCGGTTCACGTTCTACATTGCCAGCCTGA
CAGGGCACGAGGTCAAGGAGATTGAGCAGGGACCGTTGCCGGCCCACGCGAGGCTCTCCGCCGCGCCACA
CCTGATCCGCGAATCACGCAACCCGGACGGGCTGGCTGCCACGCTCTCCCACTATTTCGGGGTACCGGTC
AAGATCGATGAGTTCGTCTTTCACTGGCTTGAACGCAAGCCCGGCAAACGCAGCAGGCTGGGGGTACCCG
GAGCCGCCACGACGATGGCCGTCGATGGCTTTCTGGGAGACAGGATACCGGATCGTCAGTACCGGTTCCG
CATCGTCATTGGCCCCGTTGACATGGAAGACTATCAGCGGTTCACGCCGCAGGGCTCCGATCTGCTGCGC
CTGGTTGAATGGGTACGCGCGTTTGTTGGTCAGGAAATCCACTGGGAACTGGAACTGAAGATTCGCCCGC
ACAGCGCACCACCGGCTGTCGTGGGCGGTCCCCAGCAGCTGGGCTGGTCCGGGTGGCTCGGACAGTCTCC
GTCACCTGAACCTGTCACCGGGATGATTTTTGAGCCCGAGCGCTACGTTCCCCAGCTCAAACAGGATGCC
GAAACCCGCGCGGCCAGAGTGAAGCAGATCGAACCATGA