SecReT6
Protein ID: 186470909
SecReT6 ID275
T6SS typei3
Gene symbol-
Locus tagBphy_6124
StrainBurkholderia phymatum STM815
Repliconplasmid pBPHY01 [GenBank: NC_010625] [Browse all T6SS(s) in this replicon]
Location [Strand]676639..678783 [+]
ProductImpA family type VI secretion-associated protein
NoteTssI
UniProt IDB2JW54
KEGG IDbph:Bphy_6124
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 2.90E-74, Aligned region: 37..359
Phage_GPD [PF05954], Evalue: 2.90E-74, Aligned region: 573..643
Phage_base_V [PF04717], Evalue: 9.90E-26, Aligned region: 398..490
Gp5_C [PF06715], Evalue: 0.00087, Aligned region: 7..14
Gp5_C [PF06715], Evalue: 0.00087, Aligned region: 534..555
Gp5_C [PF06715], Evalue: 0.00087, Aligned region: 542..560
Gp5_C [PF06715], Evalue: 0.00087, Aligned region: 557..579
Gp5_C [PF06715], Evalue: 0.00087, Aligned region: 583..604
Gp5_C [PF06715], Evalue: 0.00087, Aligned region: 605..627
Protein Sequence: 714 a.a.     [Download]
>gi|186470909|ref|YP_001862227.1| unnamed protein product [Burkholderia phymatum STM815]
MLQFLTNRTLTIDGPAIPLSSTGDPVLQLQSIAGTEILSRIYRYVLDCVTVSDLLMTDAASLDLKSMIGK
ELTVTVQLDGMGSFVPGMTGLSGAANIGKGIREISGIVTEARFVGQSNRQGHYRLLLQPWITLADQQSTY
RIFQNKTVVEIVDQVFGSYMFSWDKRLSAEYKELEYQVQYGETDFIFAQRLMQEHGIYWFFEHSNKIHRM
VLVDQLGAHKPVDSAAYQTLQYYPPGHKIDMEYIDSFDASESIQSGRWTTSDFNFKKPRARLGTENALPR
DTEFNELERYEWPGDYSDTAVGEDFARIRMQELYAPGTRAWGSGNLRDVVCGTTFTLAGYPQQSANCEYL
VVSASFAASELGESTGAGEFSVRSSFVVQPATVVFRPPRTVPKPRTTGPQTAIVTGPDGQEIWTDQYGRV
KLKFHWDRSPVRNQKSSCWVRVAYPWAGNNFGTINIPRIGQEVIVDFENGDPDRPIVTGRVYNGANMPPW
PLPDNATQSGTLSRSEDGNYETANAIRFEDKKGREEVWIHAEKDMRTEVENDEVHAVEHDQTITINHDHT
KHVGNDEQVDIGHDRTHRITQDDSLAVGRSLTLTVSKDYTGNVGNNRTEKVAADYQIQTGGNVQHTVQGR
HQLQAGQGIARKTQVYELVAGERLVLKAPGGSLTIDSSGITLNGISIHLKGAVTQENGTGGAPTLNGIPV
PAQLPDPTHLPLSD
 
Nucleotide Sequence: 2145 bp     [Download]
>gi|186470346|ref|NC_010625.1|:676639-678783 Burkholderia phymatum STM815 plasmid pBPHY01, complete sequence
ATGCTGCAATTTCTGACAAACCGTACATTGACGATTGACGGTCCTGCCATCCCCCTTTCGTCCACTGGCG
ATCCAGTGCTGCAACTTCAGTCGATCGCGGGTACAGAAATTCTCTCCAGGATCTACAGGTATGTGCTGGA
TTGCGTCACTGTCTCTGATCTGTTGATGACCGATGCTGCCAGCCTCGATCTGAAATCGATGATCGGCAAG
GAGTTGACCGTCACGGTGCAGCTGGATGGCATGGGTTCCTTCGTGCCGGGAATGACGGGACTGTCTGGTG
CCGCCAATATCGGCAAAGGCATCCGGGAGATCAGCGGCATTGTTACGGAAGCACGATTTGTCGGTCAGTC
AAACCGACAGGGCCACTATCGTCTGCTCCTCCAGCCGTGGATCACGCTTGCGGATCAGCAATCGACTTAC
AGAATTTTCCAGAATAAGACGGTCGTCGAAATCGTCGATCAGGTATTTGGTTCCTACATGTTCTCCTGGG
ACAAGCGCCTGAGTGCAGAATACAAGGAACTCGAATACCAGGTCCAGTATGGTGAAACGGACTTTATATT
TGCCCAGAGGCTCATGCAGGAGCATGGCATTTACTGGTTCTTTGAGCACTCTAACAAGATCCACCGGATG
GTTCTTGTCGATCAGCTTGGTGCCCACAAGCCGGTTGATAGTGCAGCATATCAGACTCTGCAGTATTACC
CGCCCGGCCACAAGATCGATATGGAATATATTGACAGCTTCGACGCGAGCGAAAGCATTCAGTCGGGTCG
GTGGACAACGAGCGACTTCAATTTCAAGAAGCCGAGGGCACGACTCGGAACCGAAAACGCGTTGCCGCGT
GATACCGAGTTCAATGAACTGGAACGCTACGAATGGCCGGGCGACTATAGCGACACAGCCGTCGGAGAAG
ACTTCGCGCGGATACGAATGCAGGAGCTTTACGCGCCAGGCACTCGTGCTTGGGGGAGTGGCAATCTGCG
CGACGTGGTTTGTGGCACAACGTTCACGCTCGCAGGCTACCCGCAGCAAAGTGCAAATTGCGAGTACCTG
GTTGTCAGCGCATCGTTTGCAGCTTCGGAGCTGGGTGAATCCACTGGTGCGGGTGAGTTCAGTGTCCGCT
CGTCGTTCGTCGTGCAACCGGCGACCGTCGTTTTCCGTCCTCCGCGCACTGTTCCGAAACCCCGCACGAC
TGGGCCTCAAACCGCCATCGTCACTGGGCCGGATGGACAGGAAATCTGGACTGACCAGTATGGCCGCGTC
AAGTTGAAATTCCACTGGGATCGCTCGCCCGTGCGCAACCAGAAATCATCCTGCTGGGTACGTGTCGCGT
ATCCGTGGGCGGGGAACAACTTCGGCACGATCAACATTCCCCGCATCGGGCAGGAAGTCATTGTGGACTT
CGAGAACGGAGATCCCGATCGGCCGATCGTGACGGGGCGCGTCTATAACGGCGCGAATATGCCGCCGTGG
CCGCTTCCTGATAATGCCACACAAAGCGGGACGCTGTCACGTTCGGAAGACGGTAACTACGAGACGGCGA
ACGCGATCCGCTTTGAGGACAAAAAGGGACGCGAAGAGGTATGGATTCACGCTGAAAAGGACATGCGCAC
CGAGGTGGAAAACGACGAGGTGCACGCGGTGGAACATGACCAGACCATTACGATAAACCACGACCACACA
AAGCACGTGGGCAACGATGAACAGGTCGATATCGGTCACGACCGCACCCACCGCATTACCCAGGACGACT
CGCTTGCTGTCGGCCGCAGTCTCACCCTGACGGTGAGCAAGGACTACACCGGCAACGTTGGTAACAATCG
CACCGAGAAAGTCGCCGCCGACTACCAGATCCAGACCGGTGGAAACGTTCAGCACACGGTGCAGGGGCGC
CACCAGCTTCAGGCTGGACAAGGCATCGCTCGCAAGACCCAGGTCTATGAACTGGTGGCGGGAGAGCGGC
TTGTTCTGAAGGCACCTGGCGGTAGCCTCACCATCGACAGCTCGGGTATTACCCTGAACGGCATCTCCAT
CCATCTCAAGGGCGCGGTGACCCAGGAGAACGGAACGGGCGGGGCACCAACCCTTAATGGCATTCCGGTG
CCAGCGCAGTTGCCTGATCCGACCCATCTGCCGCTGTCTGACTAA