SecReT6
Protein ID: 186471748
SecReT6 ID276
T6SS typeN/A
Gene symbol-
Locus tagBphy_7014
StrainBurkholderia phymatum STM815
Repliconplasmid pBPHY01 [GenBank: NC_010625] [Browse all T6SS(s) in this replicon]
Location [Strand]1673089..1674174 [-]
ProductImpA domain-containing protein
NoteTssA
UniProt IDB2JTW7
KEGG IDbph:Bphy_7014
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.40E-21, Aligned region: 67..126
ImpA-rel_N [PF06812], Evalue: 1.40E-21, Aligned region: 208..234
Protein Sequence: 361 a.a.     [Download]
>gi|186471748|ref|YP_001863066.1| unnamed protein product [Burkholderia phymatum STM815]
MSSNGKKNPQKPGSRVATHDWMAPISAGSPCGSDLEYDPEFVVLSASVAAKATAQYGDFVGTPEPVNWSD
VDRDCRRLMVRSKDVRLAVLFTRCRTRLAAAAGFAEGLGLLSGWLATFPDQVHPQPAVDEDRSAALEIRM
NALQALTDTDGLIADLREIALTRSTATRLQLRDVERAFAHPRPSDALTPDSVTRLLDELRMRHPEVLAGF
DEALESLTAIEGWCREHLDAYAPDLGALRRMLCHVARPADSGPVHDASGDAGGAYPDSDDAALAGDLPAA
VDEHEADTAPEPRASPVTGKTPDRQAALSLIREARQWFEQHEPSSPIPVLLHRAEQFVGKRYPEVVGAIP
ADLLEQWEREA
 
Nucleotide Sequence: 1086 bp     [Download]
>gi|186470346|ref|NC_010625.1|:c1674174-1673089 Burkholderia phymatum STM815 plasmid pBPHY01, complete sequence
ATGAGCAGCAACGGGAAGAAGAACCCGCAGAAGCCCGGGAGCCGCGTCGCGACCCACGACTGGATGGCGC
CGATTTCGGCCGGATCGCCGTGCGGAAGCGATCTCGAATACGACCCGGAATTCGTCGTGCTGAGTGCGAG
CGTTGCCGCGAAGGCAACCGCGCAATACGGTGATTTCGTTGGTACACCGGAGCCGGTGAACTGGAGCGAT
GTGGACCGGGACTGCCGCCGTCTGATGGTACGCAGCAAGGACGTGCGTCTGGCCGTACTCTTTACACGGT
GTCGGACACGGCTCGCGGCCGCCGCCGGCTTCGCGGAGGGGCTGGGCCTGTTGTCCGGATGGCTGGCCAC
CTTCCCGGATCAGGTACACCCGCAACCTGCAGTGGACGAAGACCGTTCGGCCGCGCTCGAAATCCGCATG
AACGCGCTGCAGGCGTTGACCGACACCGATGGGCTGATCGCGGATCTGAGGGAAATCGCGCTGACCCGGT
CGACGGCCACGCGCCTGCAGTTGCGGGATGTCGAGCGGGCGTTTGCGCATCCCAGACCAAGTGACGCGCT
GACACCGGACTCCGTGACCAGGCTGCTTGACGAGCTGCGCATGCGGCACCCCGAGGTCCTTGCCGGCTTT
GACGAGGCGCTGGAAAGCCTGACTGCGATCGAAGGCTGGTGCCGGGAGCACCTGGATGCCTACGCCCCCG
ATCTCGGCGCGCTCAGACGAATGCTTTGCCATGTTGCCCGGCCGGCGGACAGTGGCCCGGTGCATGACGC
CAGCGGCGACGCAGGCGGGGCATACCCGGATAGCGATGATGCCGCACTGGCGGGAGACCTGCCGGCTGCA
GTTGATGAGCATGAAGCGGACACGGCGCCCGAACCGCGAGCCAGCCCTGTAACCGGAAAGACTCCCGATC
GCCAGGCGGCGCTCAGTCTGATCCGAGAAGCGCGGCAGTGGTTCGAGCAGCATGAGCCCAGCAGCCCGAT
TCCGGTGCTGCTGCACAGGGCCGAGCAGTTCGTTGGCAAGCGCTACCCGGAGGTCGTCGGGGCGATTCCG
GCGGACCTTCTTGAACAGTGGGAGCGTGAAGCATGA