SecReT6
Protein ID: 186471749
SecReT6 ID276
T6SS typeN/A
Gene symbol-
Locus tagBphy_7015
StrainBurkholderia phymatum STM815
Repliconplasmid pBPHY01 [GenBank: NC_010625] [Browse all T6SS(s) in this replicon]
Location [Strand]1674171..1675247 [-]
Producttype VI secretion protein
NoteTssG
UniProt IDB2JTW8
KEGG IDbph:Bphy_7015
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.30E-102, Aligned region: 24..325
Protein Sequence: 358 a.a.     [Download]
>gi|186471749|ref|YP_001863067.1| unnamed protein product [Burkholderia phymatum STM815]
MERAAQDSLLFGRKLSPALLEHLQAEPWRYGFISLMRRIGADPAIDPVGTAALPDAESFRLGQRPSLIFA
PREIADASVKNGKLHMRLFGLGMLGPNGPLPIHVTEIAREREEQRRDPALSNFLDIFHHRSMTLFYRAWA
SAQSAASLDRPEHDRFSLYVASLSGYPLRRERPWPLPAHARLSAAPHLVREARNPEGLCSALAHYFGVPV
RLDEFVLHWMELAPENCCVMGEHRASSFMGSGAVIGGHVPDRQYRFRIVIGPLDIEDYHRFTPQGADLLR
LIEWVRAFVSEEFDWELELQIKPHSAPSAVLGGPQQLGWSSWMGQSPSSEPVTGMCFEPERYVQQLRQNM
IKQERIEP
 
Nucleotide Sequence: 1077 bp     [Download]
>gi|186470346|ref|NC_010625.1|:c1675247-1674171 Burkholderia phymatum STM815 plasmid pBPHY01, complete sequence
ATGGAGCGGGCGGCACAAGACTCACTCCTCTTCGGCAGAAAGCTGTCGCCGGCATTGCTCGAGCATCTGC
AGGCCGAACCCTGGCGGTACGGGTTCATTTCGCTGATGCGCCGCATCGGTGCGGATCCGGCGATTGACCC
GGTGGGGACCGCGGCGCTGCCCGATGCAGAGTCCTTCCGCCTGGGGCAGCGACCGAGCCTCATCTTCGCG
CCGCGTGAGATCGCGGATGCCTCGGTGAAGAACGGCAAGCTGCACATGCGGCTCTTTGGCCTGGGCATGC
TGGGGCCGAACGGGCCGCTGCCGATCCACGTCACGGAGATTGCACGCGAGCGTGAGGAGCAAAGACGGGA
CCCCGCGCTCAGCAACTTTCTGGACATCTTCCATCACCGGTCGATGACGCTGTTCTATCGCGCCTGGGCC
TCGGCGCAGTCGGCCGCCAGTCTCGACCGGCCCGAACATGACCGGTTTTCGCTCTATGTCGCCAGTCTTT
CCGGCTATCCGCTAAGGCGGGAGCGGCCATGGCCGCTCCCTGCACACGCGCGCCTGTCGGCGGCGCCGCA
TCTCGTGCGCGAGGCCCGCAATCCGGAGGGGCTGTGCAGCGCGCTCGCCCATTACTTTGGCGTGCCGGTC
AGGCTTGACGAGTTCGTCCTGCACTGGATGGAGCTGGCGCCGGAGAACTGCTGTGTCATGGGCGAGCACC
GGGCCTCGTCGTTCATGGGCTCGGGCGCGGTGATCGGCGGGCATGTGCCCGACCGCCAGTACCGGTTTCG
CATCGTGATTGGCCCGCTGGATATCGAGGACTATCACCGCTTCACGCCACAGGGGGCGGACCTGCTGCGG
TTGATCGAATGGGTGCGGGCTTTCGTGAGCGAGGAGTTCGACTGGGAACTCGAGCTGCAGATCAAGCCGC
ACAGCGCGCCTTCGGCCGTGCTGGGTGGTCCGCAGCAACTCGGCTGGTCCAGCTGGATGGGGCAGTCGCC
TTCGTCTGAGCCGGTTACCGGAATGTGTTTCGAGCCGGAGCGCTACGTGCAGCAGCTCCGGCAGAACATG
ATCAAGCAGGAAAGAATCGAACCATGA