SecReT6
Protein ID: 186471751
SecReT6 ID276
T6SS typeN/A
Gene symbol-
Locus tagBphy_7017
StrainBurkholderia phymatum STM815
Repliconplasmid pBPHY01 [GenBank: NC_010625] [Browse all T6SS(s) in this replicon]
Location [Strand]1675944..1677233 [-]
Producthypothetical protein
NoteTssL
UniProt IDB2JTX0
KEGG IDbph:Bphy_7017
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.00E-61, Aligned region: 53..264
OmpA [PF00691], Evalue: 7.70E-15, Aligned region: 324..421
Protein Sequence: 429 a.a.     [Download]
>gi|186471751|ref|YP_001863069.1| unnamed protein product [Burkholderia phymatum STM815]
MSDKAALLRGTARDTEAQSYADAAVSGQEGLPYEVPLGEPALERLTKVRSAANPLLEAARVLLRSQADIP
EMDLGAKGVIPTLRQLLLDEMKTFQKLCEQTSIRRDHMIGARYCLCTALDEAVMETPWGRTGDNGVSWGT
VGLATNFHEDRDGGTKIYLLVARLMQDPDQHDDLLEVIYHILSFGFEGRYRSERDGHRKHEAVRQRIYNE
IMARRPPVPVELSPHARSDVPPRRQSFYDFPVWITVTVLSLILLGMWGYFKYQLVTRADDIQKQIGDIAR
MTPPPAPPVLHLKTLLKDEIAAGTVSVDEDAKHSAVTFRGDSMFPPGGVAVNTSMGPLIAKIAAEIVKVP
GKVTVLGYTDNLPIHSHAFASNDALSAERATQVLQMLQADGVPASRLEAMGKGEADPVADNSTPQGRAQN
RRVEIHVAE
 
Nucleotide Sequence: 1290 bp     [Download]
>gi|186470346|ref|NC_010625.1|:c1677233-1675944 Burkholderia phymatum STM815 plasmid pBPHY01, complete sequence
ATGAGCGACAAGGCTGCGCTTTTGAGGGGTACGGCACGCGATACCGAAGCCCAGTCCTATGCTGACGCCG
CTGTGTCCGGCCAGGAAGGGCTGCCCTATGAGGTTCCACTGGGCGAGCCGGCTCTGGAGCGGCTGACCAA
AGTCCGCTCGGCTGCAAACCCGCTGCTCGAAGCTGCGCGTGTGCTGTTGCGGTCGCAGGCCGACATTCCG
GAAATGGATCTCGGTGCGAAAGGTGTTATCCCGACCCTGCGGCAGTTGCTGCTCGATGAGATGAAAACCT
TCCAGAAGCTCTGCGAGCAGACCAGCATTCGGCGCGACCACATGATTGGCGCCCGCTACTGCCTGTGTAC
CGCCCTCGATGAAGCGGTCATGGAGACGCCATGGGGCCGTACAGGAGACAATGGTGTGTCATGGGGAACA
GTGGGCCTCGCGACCAACTTCCACGAGGACCGTGACGGAGGAACCAAGATCTATCTGCTCGTCGCGCGCT
TGATGCAGGATCCGGACCAGCACGACGACCTGCTTGAAGTGATCTACCACATCCTGAGCTTCGGTTTTGA
GGGCCGTTACCGTAGCGAGCGCGACGGTCATCGCAAGCACGAAGCCGTTCGCCAGCGTATCTACAACGAG
ATCATGGCGCGGCGGCCGCCGGTGCCGGTGGAACTTTCCCCGCACGCCCGCAGCGACGTGCCGCCCAGGC
GCCAGTCGTTCTATGACTTTCCGGTCTGGATTACGGTTACCGTGCTCTCGCTCATTCTGCTTGGCATGTG
GGGCTACTTCAAGTACCAGCTCGTGACACGTGCCGACGATATCCAGAAGCAGATCGGTGACATCGCACGC
ATGACGCCGCCACCTGCGCCGCCGGTGCTACATCTGAAAACCCTACTCAAGGACGAGATCGCCGCCGGCA
CCGTGAGCGTGGACGAGGACGCGAAGCACAGCGCGGTGACGTTCCGCGGCGACTCGATGTTCCCGCCCGG
CGGTGTTGCGGTCAACACGTCAATGGGGCCGCTGATCGCAAAGATTGCCGCCGAGATCGTCAAGGTGCCG
GGCAAGGTCACGGTGCTGGGCTACACGGACAACCTCCCGATCCACAGCCACGCATTCGCTTCCAATGATG
CGCTGTCGGCCGAGCGTGCCACGCAGGTGCTGCAGATGCTGCAGGCCGACGGTGTACCTGCCAGCCGTCT
CGAAGCCATGGGCAAGGGCGAAGCTGACCCGGTTGCCGATAACAGCACGCCACAGGGCCGCGCCCAGAAC
CGTCGGGTCGAGATCCATGTTGCGGAATGA