SecReT6
Protein ID: 186471756
SecReT6 ID276
T6SS typeN/A
Gene symbol-
Locus tagBphy_7022
StrainBurkholderia phymatum STM815
Repliconplasmid pBPHY01 [GenBank: NC_010625] [Browse all T6SS(s) in this replicon]
Location [Strand]1682001..1684541 [-]
ProductImpA family type VI secretion-associated protein
NoteTssI
UniProt IDB2JTX5
KEGG IDbph:Bphy_7022
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 2.20E-69, Aligned region: 34..380
Phage_GPD [PF05954], Evalue: 2.20E-69, Aligned region: 623..643
DUF2345 [PF10106], Evalue: 4.60E-50, Aligned region: 663..815
T6SS_Vgr [PF13296], Evalue: 5.40E-35, Aligned region: 528..634
T6SS_Vgr [PF13296], Evalue: 5.40E-35, Aligned region: 636..659
Phage_base_V [PF04717], Evalue: 3.50E-12, Aligned region: 5..28
Phage_base_V [PF04717], Evalue: 3.50E-12, Aligned region: 422..512
Phage_base_V [PF04717], Evalue: 3.50E-12, Aligned region: 561..576
Protein Sequence: 846 a.a.     [Download]
>gi|186471756|ref|YP_001863074.1| unnamed protein product [Burkholderia phymatum STM815]
MFKPLQPRTLSVASDALPLRAGEPVLIAQRVHGTEALGNLFDYRVELATRDTPTCRLSDAQPLVIPGQLI
GKSLTISIEFEGKGVFVPGMPGNLGAANVGAGVRQITGLITAVSSTGSDDRRAYYELTVRPWLWMATQNS
ESRAYQNLNVVEVTQAILKGGQYPWPYELRLGAVGLQNNVYPPRDYVRQYWESDYAFLTRIWREWGIYYL
FDGMTLVLCDSPGSHKKHHDAYDTVTYHAPDGKRIDEEHIHRLRISQQITPGDVTLNDYDYTRSLGKFDV
NQSQYSKSSFDNIEQYHWGEYSQPLAGAMGLSGDPNDYDTEGAYLARVRLNALRCRRLRIYGTGNLRGLT
TGKTFRLEGHPQREVNADYLVVSTSLDVRNPDEITRSAGDGVQYQCVTDFVLQPASAFFKNRLRKKPQAH
AETAVVVGPANRPVWLDGYARTKVSFLWDRHSSRDENSSCWVRVGLPWHGGPHSFIAVPRIGDELTIDYH
EGDPDKPYISASKVNEFNQPPFELPKNQALTGLVGSGLDGKGHNYVVTDDTPGQLQVQVASDQDYSRLSL
GYITRIDYGTGRQQARGSGWELATDAWGVLRANRGMLITTEARGGAQAAAKDMGETVQRLTKARDTHESL
AELAQQNNAQEQGADQSEITAALKAQNDAIRGGAKSGPNDFPEFAEAHVTIASPSGIETTTAGSTHIASG
EHLALTAGEHLGMAVGKSLFATIREKLRIFVYQSGIRLIAGAGSIDIQALSDAVNVLAKLKIHQSAKRIE
IWAEEELSLRGGKSYLTLNNAGIENGTPGQWQSYASTHQMPGPKSGPEDVPAAQLNVCEMSAASASSQHA
AIVPLA
 
Nucleotide Sequence: 2541 bp     [Download]
>gi|186470346|ref|NC_010625.1|:c1684541-1682001 Burkholderia phymatum STM815 plasmid pBPHY01, complete sequence
ATGTTCAAACCGTTGCAGCCCCGCACACTGAGCGTGGCGTCCGACGCGTTGCCCCTCCGCGCTGGCGAGC
CCGTGCTCATTGCCCAGCGCGTGCATGGCACCGAGGCACTGGGCAACCTCTTTGATTACCGGGTGGAGCT
GGCCACGCGGGACACCCCGACCTGTCGGCTGTCGGATGCGCAGCCGCTCGTGATCCCCGGGCAGCTGATC
GGCAAGTCCCTCACCATTTCGATCGAGTTCGAGGGTAAGGGCGTATTCGTGCCGGGCATGCCCGGCAACC
TTGGGGCCGCGAATGTCGGTGCCGGGGTGCGCCAGATTACCGGCCTCATCACCGCGGTTTCCAGCACGGG
CAGTGACGACCGGCGGGCGTATTACGAACTGACGGTTCGTCCCTGGCTCTGGATGGCCACCCAGAACAGC
GAAAGCCGTGCTTACCAGAACCTCAATGTGGTCGAGGTGACCCAGGCGATACTCAAGGGCGGGCAGTATC
CGTGGCCCTACGAACTGCGGCTGGGCGCAGTGGGCCTGCAAAACAACGTCTATCCGCCGCGCGACTACGT
CCGCCAGTACTGGGAGAGTGATTACGCGTTCCTGACCAGAATCTGGCGCGAATGGGGGATTTATTACCTG
TTCGATGGCATGACGCTGGTCCTCTGCGATTCGCCAGGTTCCCACAAGAAGCACCACGACGCGTACGACA
CCGTAACGTACCACGCACCCGACGGCAAGCGCATTGATGAAGAGCATATTCACAGGCTCCGGATCTCGCA
GCAGATCACGCCGGGCGATGTGACGCTCAACGACTACGACTACACGCGCTCACTCGGGAAGTTCGACGTG
AACCAGTCGCAGTACAGCAAGTCGTCATTCGACAATATCGAGCAGTACCACTGGGGCGAATACTCGCAGC
CGCTCGCGGGCGCCATGGGGCTGTCGGGCGATCCGAATGACTATGACACGGAGGGCGCGTACCTGGCGCG
CGTGCGGTTGAATGCGCTGCGTTGCCGGCGGCTGCGCATCTATGGCACGGGCAACCTTCGCGGCCTGACC
ACGGGCAAGACGTTCCGGCTTGAAGGGCATCCGCAGCGAGAAGTCAACGCGGACTATCTCGTGGTGTCGA
CCTCGCTCGATGTGCGCAATCCGGACGAGATCACGCGCTCAGCGGGCGACGGTGTGCAGTACCAGTGTGT
GACCGATTTCGTGCTGCAGCCGGCCAGTGCGTTCTTCAAGAACCGGCTGAGAAAGAAGCCGCAGGCCCAT
GCCGAAACCGCCGTGGTTGTGGGACCCGCCAACCGGCCGGTCTGGCTCGATGGTTACGCACGTACCAAGG
TTTCCTTTCTGTGGGACCGGCACAGCAGCCGTGACGAAAATTCGAGCTGCTGGGTGCGCGTGGGTTTGCC
CTGGCATGGTGGGCCGCACAGCTTTATCGCGGTGCCGCGCATCGGCGACGAGCTGACAATCGACTATCAC
GAGGGCGACCCCGACAAGCCCTACATCTCGGCGAGCAAGGTCAACGAGTTCAACCAGCCACCGTTCGAGC
TGCCGAAGAATCAGGCGCTTACGGGGCTGGTGGGCAGCGGTCTGGACGGCAAGGGCCATAACTACGTGGT
GACCGACGATACCCCCGGCCAGTTGCAGGTCCAGGTGGCGAGCGATCAGGACTACTCGCGTCTCTCTCTC
GGCTACATCACCCGGATCGACTACGGCACGGGTCGGCAGCAGGCACGCGGAAGCGGATGGGAACTGGCCA
CGGACGCGTGGGGCGTGCTGCGCGCCAATCGTGGCATGCTGATTACCACAGAGGCCCGTGGTGGTGCGCA
GGCTGCAGCCAAGGACATGGGCGAGACGGTGCAGCGCCTGACCAAGGCCCGCGATACCCACGAAAGTCTC
GCAGAGCTTGCCCAGCAAAACAATGCGCAGGAGCAGGGCGCAGACCAGAGTGAAATCACGGCCGCCCTCA
AGGCGCAGAACGATGCAATTCGCGGCGGCGCGAAAAGCGGTCCCAACGACTTCCCGGAATTTGCCGAAGC
CCATGTCACCATCGCCAGTCCTTCGGGCATTGAGACGACCACGGCAGGCAGCACCCACATCGCGAGCGGT
GAACACCTCGCGCTGACGGCGGGCGAACATCTGGGTATGGCGGTCGGCAAGTCGCTGTTTGCGACGATCC
GCGAGAAGCTGAGGATCTTTGTTTACCAGTCAGGAATCCGGCTGATCGCCGGAGCGGGATCGATCGACAT
CCAGGCGCTGTCCGACGCAGTCAATGTGCTGGCAAAACTCAAGATTCACCAGAGCGCGAAGCGCATCGAG
ATCTGGGCGGAAGAAGAGCTTTCGCTGCGCGGAGGCAAAAGCTATCTGACGCTCAACAATGCCGGCATCG
AAAATGGCACGCCCGGCCAGTGGCAGTCCTACGCCTCGACCCACCAGATGCCGGGGCCAAAGAGCGGCCC
CGAAGACGTGCCCGCCGCGCAGCTCAACGTCTGCGAGATGAGTGCCGCTAGCGCATCGAGCCAGCACGCC
GCCATCGTTCCCCTTGCCTGA